AGI ID: At1g51950

TF ID:TF_55
Super family:Aux/IAA
Sub family:
Gene name: IAA18 early auxin-induced protein

Amino Acid Sequence:


1
61
121
181
241
>At1g51950
MEGYSRNGEI SPKLLDLMIP QERRNWFHDE KNSVFKTEEK KLELKLGPPG EEDDDESMIR
HMKKEPKDKS ILSLAGKYFS PSSTKTTSHK RTAPGPVVGW PPVRSFRKNL ASGSSSKLGN
DSTTSNGVTL KNQKCDAAAK TTEPKRQGGM FVKINMYGVP IGRKVDLSAH NSYEQLSFTV
DKLFRGLLAA QRDFPSSIED EKPITGLLDG NGEYTLTYED NEGDKMLVGD VPWQMFVSSV
KRLRVIKTSE ISSALTYGNG KQEKMRR
Length = 267 AA.

PSI BLAST Result:

Query: Query sequence of TF_55
Sbjct: At1g51950

>At1g51950 IAA18 early auxin-induced protein
          Length = 267

 Score =  202 bits (513), Expect = 2e-52
 Identities = 68/248 (27%), Positives = 100/248 (39%), Gaps = 50/248 (20%)

Query: 10  RETELCLGLPGGDTVAPVT---GNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKE 66
           ++ EL LG PG +           K    E  D  + L+        S+T       +  
Sbjct: 40  KKLELKLGPPGEEDDDESMIRHMKK----EPKDKSI-LSLAGKYFSPSSTKTTSHKRTA- 93

Query: 67  XXXXXXXXXXXXXXXQVVGWPLVRSYRKNVMVSCQKSSGGP------------------- 107
                           VVGWP VRS+RKN+        G                     
Sbjct: 94  -------------PGPVVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAK 140

Query: 108 ------EAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMID 161
                 +   FVK++M G P  RK+DL  + SY++LS  +  +F      +      + D
Sbjct: 141 TTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIED 200

Query: 162 FMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSD-AIGLAPR 220
                 L+D   + +Y  +YED +GD MLVGDVPW MFV + KRLR++K S+ +  L   
Sbjct: 201 EKPITGLLD--GNGEYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEISSALTYG 258

Query: 221 AMEKCKSR 228
             ++ K R
Sbjct: 259 NGKQEKMR 266


InterPro Results:

IPR003311 Family
PF02309 T[40-261] 4.1e-25 AUX_IAA
AUX/IAA protein
NULL
seg ?[38-52] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_55 Aux/IAA202 2e-52
TF_17_2 ARFNPH4/ARF7203 6e-52
TF_17_1 ARFMONOPTEROS/ARF5123 5e-28

TOP