AGI ID: At1g51190

TF ID:TF_2_2
Super family:AP2/EREBP
Sub family:AINTEGUMENTA
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At1g51190
MNSNNWLAFP LSPTHSSLPP HIHSSQNSHF NLGLVNDNID NPFQNQGWNM INPHGGGGEG
GEVPKVADFL GVSKSGDHHT DHNLVPYNDI HQTNASDYYF QTNSLLPTVV TCASNAPNNY
ELQESAHNLQ SLTLSMGSTG AAAAEVATVK ASPAETSADN SSSTTNTSGG AIVEATPRRT
LETFGQRTSI YRGVTRHRWT GRYEAHLWDN SCRREGQSRK GRQGGYDKEE KAARAYDLAA
LKYWGPSTTT NFPITNYEKE VEEMKNMTRQ EFVASIRRKS SGFSRGASMY RGVTRHHQHG
RWQARIGRVA GNKDLYLGTF STEEEAAEAY DIAAIKFRGL NAVTNFEINR YDVKAILESN
TLPIGGGAAK RLKEAQALES SRKREEMIAL GSNFHQYGAA SGSSSVASSS RLQLQPYPLS
IQQPFEHLHH HQPLLTLQNN NDISQYHDSF SYIQTQLHLH QQQTNNYLQS SSHTSQLYNA
YLQSNPGLLH GFVSDNNNTS GFLGNNGIGI GSSSTVGSSA EEEFPAVKVD YDMPPSGGAT
GYGGWNSGES AQGSNPGGVF TMWNE
Length = 565 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_2
Sbjct: At1g51190

>At1g51190 unknown protein
          Length = 565

 Score =  330 bits (847), Expect = 9e-91
 Identities = 177/380 (46%), Positives = 215/380 (56%), Gaps = 47/380 (12%)

Query: 112 SSPKVEDFFGTHHNNTSHKEAMDLSLDSLFYNTTHEPNTTTNFQEFFSFPQTRNHEEETR 171
             PKV DF G   +   H    D +L    YN  H+ N +  +  F +            
Sbjct: 62  EVPKVADFLGVSKSGDHHT---DHNLVP--YNDIHQTNASDYY--FQTNSLLPTVVTCAS 114

Query: 172 NYGNDPSLTHGGSFNVGVYGEFXXXXXXXXXXXXXXXCITGXXXXXXXXXXXXXXXXXXX 231
           N  N+  L                               TG                   
Sbjct: 115 NAPNNYELQESAHNLQS---------------LTLSMGSTG--------------AAAAE 145

Query: 232 ISEALVETSVGFETTTMAAAKKKRGQEDVVVVGQKQIVHRKSIDTFGQRTSQYRGVTRHR 291
           ++      +      + +      G          +   R++++TFGQRTS YRGVTRHR
Sbjct: 146 VATVKASPAETSADNSSSTTNTSGGA-------IVEATPRRTLETFGQRTSIYRGVTRHR 198

Query: 292 WTGRYEAHLWDNSFKKEGHSRKGRQVYLGGYDMEEKAARAYDLAALKYWGPSTHTNFSAE 351
           WTGRYEAHLWDNS ++EG SRKGRQ   GGYD EEKAARAYDLAALKYWGPST TNF   
Sbjct: 199 WTGRYEAHLWDNSCRREGQSRKGRQ---GGYDKEEKAARAYDLAALKYWGPSTTTNFPIT 255

Query: 352 NYQKEIEDMKNMTRQEYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDL 411
           NY+KE+E+MKNMTRQE+VA +RRKSSGFSRGAS+YRGVTRHHQHGRWQARIGRVAGNKDL
Sbjct: 256 NYEKEVEEMKNMTRQEFVASIRRKSSGFSRGASMYRGVTRHHQHGRWQARIGRVAGNKDL 315

Query: 412 YLGTFGTQEEAAEAYDVAAIKFRGTNAVTNFDITRYDVDRIMSSNT-LLSGELARRNNNS 470
           YLGTF T+EEAAEAYD+AAIKFRG NAVTNF+I RYDV  I+ SNT  + G  A+R   +
Sbjct: 316 YLGTFSTEEEAAEAYDIAAIKFRGLNAVTNFEINRYDVKAILESNTLPIGGGAAKRLKEA 375

Query: 471 IVVRNTEDQTALNAVVEGGS 490
             + ++  +  + A+     
Sbjct: 376 QALESSRKREEMIALGSNFH 395


InterPro Results:

IPR001471 Domain
PD001423 T[300-340] 9e-12 sp_Q9SYC2_ARATH_Q9SYC2;
PR00367 T[191-202] 5e-07T[329-349] 5e-07 ETHRSPELEMNT
PF00847 T[189-258] 3.2e-32T[288-352] 7.7e-33 AP2
SM00380 T[190-259] 3.4e-23T[289-353] 1.5e-32 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[10-25]?[55-62]?[137-154]?[156-171]?[323-329]?[398-410]?[427-441]?[454-466]?[500-519] seg
SSF54171 T[189-255] 1.6e-17T[288-349] 4.6e-20 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_2 AP2/EREBPAINTEGUMENTA330 9e-91
TF_2_3 AP2/EREBPAPETALA2261 5e-70
TF_67 Pti6119 1e-27
TF_2_4 AP2/EREBPCBF1116 8e-27
TF_66 Pti5 99 9e-22
TF_68 ERF 99 2e-21
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 83 1e-16
TF_2_5 AP2/EREBPDREB2A 42 4e-04

TOP