AGI ID: At1g51120

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g51120
MDEMSNVAKT TTETSGLTDS VLSLTKRMKP TEVTTTTKPA LSNTTKFKGV VQQQNGHWGA
QIYADHRRIW LGTFKSAHEA AAAYDSASIK LRSFDANSHR NFPWSDFTLH EPDFQECYTT
EAVLNMIRDG SYQHKFRDFL RIRSQIVANI NIVGSKQVLG GGEGGQESNK CFSCTQLFQK
ELTPSDVGKL NRLVIPKKYA VKYMPFISDD QSEKETSEGV EDVEVVFYDR AMRQWKFRYC
YWRSSQSFVF TRGWNGFVKE KNLKEKDIIV FYTCDVPNNV KTLEGQSKTF LMIDVHHFSG
NGFVVPEEVN KTVHEISDEE MKTETLFTSK VEEETKSEEK KGGFMLFGVR IQ
Length = 352 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At1g51120

>At1g51120 hypothetical protein
          Length = 352

 Score =  148 bits (373), Expect = 1e-35
 Identities = 31/115 (26%), Positives = 48/115 (40%), Gaps = 7/115 (6%)

Query: 142 GGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQ---- 197
           GGE   E  K  +   +F K LT SD        +P++ A    P +   Q         
Sbjct: 161 GGEGGQESNKCFSCTQLFQKELTPSDVGKLNRLVIPKKYAVKYMPFISDDQSEKETSEGV 220

Query: 198 ---ELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGD 249
              E++  D    +W+FR+ Y    +  + T GW+ FV +K L   D ++F   D
Sbjct: 221 EDVEVVFYDRAMRQWKFRYCYWRSSQSFVFTRGWNGFVKEKNLKEKDIIVFYTCD 275


InterPro Results:

IPR001471 Domain
PD001423 T[56-92] 2e-07 sp_Q9C688_ARATH_Q9C688;
PR00367 T[47-58] 6.4e-05T[67-83] 6.4e-05 ETHRSPELEMNT
PF00847 T[45-108] 3.6e-16 AP2
SM00380 T[46-109] 4.2e-16 AP2
Pathogenesis-related transcriptional factor and ERF
IPR003340 Family
PF02362 T[177-291] 1.2e-25 B3
Transcriptional factor B3
NULL
seg ?[76-88]?[328-341] seg
SSF54171 T[45-105] 3.4e-15 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3148 1e-35
TF_17_1 ARFMONOPTEROS/ARF5134 3e-31
TF_17_2 ARFNPH4/ARF7123 9e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3111 2e-24
TF_22_1 ABI3/VP1FUSCA3104 7e-23
TF_2_2 AP2/EREBPAINTEGUMENTA 94 2e-19
TF_2_4 AP2/EREBPCBF1 92 2e-19
TF_67 Pti6 89 2e-18
TF_68 ERF 80 1e-15
TF_2_3 AP2/EREBPAPETALA2 77 1e-14
TF_66 Pti5 69 9e-13
TF_2_5 AP2/EREBPDREB2A 66 4e-11
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 60 2e-09
TF_65 Pti4 59 3e-09

TOP