AGI ID: At1g50680

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g50680
MRLDDEPENA LVVSSSPKTV VASGNVKYKG VVQQQNGHWG AQIYADHKRI WLGTFKSADE
AATAYDSASI KLRSFDANSH RNFPWSTITL NEPDFQNCYT TETVLNMIRD GSYQHKFRDF
LRIRSQIVAS INIGGPKQAR GEVNQESDKC FSCTQLFQKE LTPSDVGKLN RLVIPKKYAV
KYMPFISADQ SEKEEGEIVG SVEDVEVVFY DRAMRQWKFR YCYWKSSQSF VFTRGWNSFV
KEKNLKEKDV IAFYTCDVPN NVKTLEGQRK NFLMIDVHCF SDNGSVVAEE VSMTVHDSSV
QVKKTENLVS SMLEDKETKS EENKGGFMLF GVRIECP
Length = 337 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At1g50680

>At1g50680 hypothetical protein
          Length = 337

 Score =  143 bits (362), Expect = 2e-34
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 10/118 (8%)

Query: 142 GGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQ---- 197
            GE + E  K  +   +F K LT SD        +P++ A    P +   Q    +    
Sbjct: 140 RGEVNQESDKCFSCTQLFQKELTPSDVGKLNRLVIPKKYAVKYMPFISADQSEKEEGEIV 199

Query: 198 ------ELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGD 249
                 E++  D    +W+FR+ Y    +  + T GW++FV +K L   D + F   D
Sbjct: 200 GSVEDVEVVFYDRAMRQWKFRYCYWKSSQSFVFTRGWNSFVKEKNLKEKDVIAFYTCD 257


InterPro Results:

IPR001471 Domain
PD001423 T[37-73] 5e-15 sp_Q9C6P5_ARATH_Q9C6P5;
PR00367 T[28-39] 7.5e-06T[48-64] 7.5e-06 ETHRSPELEMNT
PF00847 T[26-89] 1.1e-17 AP2
SM00380 T[27-90] 2e-16 AP2
Pathogenesis-related transcriptional factor and ERF
IPR003340 Family
PF02362 T[156-273] 6.8e-22 B3
Transcriptional factor B3
NULL
SSF54171 T[26-86] 6.9e-16 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3143 2e-34
TF_17_1 ARFMONOPTEROS/ARF5130 5e-30
TF_17_2 ARFNPH4/ARF7120 7e-27
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3112 7e-25
TF_22_1 ABI3/VP1FUSCA3105 3e-23
TF_2_4 AP2/EREBPCBF1 95 3e-20
TF_67 Pti6 85 4e-17
TF_2_3 AP2/EREBPAPETALA2 85 7e-17
TF_68 ERF 83 8e-17
TF_2_2 AP2/EREBPAINTEGUMENTA 85 1e-16
TF_66 Pti5 64 4e-11
TF_2_5 AP2/EREBPDREB2A 65 6e-11
TF_65 Pti4 61 7e-10
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 60 2e-09

TOP