AGI ID: At1g50220

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At1g50220
MKIKHWDRWL ASLKDDDYLK NIEAIKLYLA VMSIYEPDLL DEYMIDDDFH PMISRLKNVT
LDVTSARFKE LYITESKMNY ARDELDGAMI ISKTLTKSDI VGNVALPKAQ VMSVLTRMNG
VTDEGLDNGF EVQVHDIMED DLYTVTLKRI DDMKYYFGTG WSTMKHSLDL VEGDVQKLYW
DQFENKFIVL NFQHKTMGIM IPV
Length = 203 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At1g50220

>At1g50220 hypothetical protein
          Length = 203

 Score = 82.2 bits (202), Expect = 3e-16
 Identities = 19/111 (17%), Positives = 40/111 (35%), Gaps = 10/111 (9%)

Query: 83  DPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPAL------ECKEGIPIRMEDLDGF 136
           D      +  K L  SD+  +  + LPK    + L  +          G  +++ D+   
Sbjct: 83  DELDGAMIISKTLTKSDI--VGNVALPKAQVMSVLTRMNGVTDEGLDNGFEVQVHDIMED 140

Query: 137 HVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVI 187
            ++T   +   +     Y         ++  L  GD   +Y D + N +++
Sbjct: 141 DLYTVTLKRIDDMK--YYFGTGWSTMKHSLDLVEGDVQKLYWDQFENKFIV 189


Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 82 3e-16
TF_17_2 ARFNPH4/ARF7 84 4e-16
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 74 2e-13

TOP