AGI ID: At1g49560

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g49560
MGSLGDELSL GSIFGRGVSM NVVAVEKVDE HVKKLEEEKR KLESCQLELP LSLQILNDAI
LYLKDKRCSE METQPLLKDF ISVNKPIQGE RGIELLKREE LMREKKFQQW KANDDHTSKI
KSKLEIKRNE EKSPMLLIPK VETGLGLGLS SSSIRRKGIV ASCGFTSNSM PQPPTPAVPQ
QPAFLKQQAL RKQRRCWNPE LHRRFVDALQ QLGGPGVATP KQIREHMQEE GLTNDEVKSH
LQKYRLHIRK PNSNAEKQSA VVLGFNLWNS SAQDEEETCE GGESLKRSNA QSDSPQGPLQ
LPSTTTTTGG DSSMEDVEDA KSESFQLERL RSP
Length = 333 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g49560

>At1g49560 unknown protein
          Length = 333

 Score =  115 bits (288), Expect = 9e-26
 Identities = 36/64 (56%), Positives = 42/64 (65%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
               K R  W PELH RFV+A+  LGGP  ATPK I + M  +GLT   +KSHLQKYRL+
Sbjct: 188 QALRKQRRCWNPELHRRFVDALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRLH 247

Query: 243 IRLP 246
           IR P
Sbjct: 248 IRKP 251


InterPro Results:

IPR001005 Domain
PF00249 T[194-245] 1.5e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[192-248] 1.3e-32 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[188-252] 3.1e-18 Homeodomain-like
Homeodomain-like
NULL
coil ?[25-49] coiled-coil
seg ?[33-43]?[94-106]?[144-153]?[171-183]?[304-310] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like115 9e-26
TF_10_2 GARPARR-B class 95 8e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 79 6e-15
TF_1_2 MYB superfamilyLHY 74 3e-13

TOP