AGI ID: At1g49480

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: Unknown protein

Amino Acid Sequence:


1
61
121
181
>At1g49480
MQMDSAQNQF NKRARLFEDP ELKDAKVIYP SNPESTEPVN KGYGGSTAIQ SFFKESKAEE
TPKVLKKRGR KKKNPNPEEV NSSTPGGDDS ENRSKFYESA SARKRTVTAE ERERAVNAAK
TFEPTNPYFR VVLRPSYLYR GCIMYLPSGF AEKYLSGISG FIKLQLGEKQ WPVRCLYKAG
RAKFSQGWYE FTLENNIGEG DVCVFELLRT RDFVLEVTAF RVNEYV
Length = 226 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At1g49480

>At1g49480 Unknown protein
          Length = 226

 Score = 88.8 bits (219), Expect = 1e-17
 Identities = 27/141 (19%), Positives = 45/141 (31%), Gaps = 12/141 (8%)

Query: 535 QLPTMDRAGSASAMPRQQVVPDRRQ---GWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKK 591
                    SASA  R     +R +     K  +      + VL+ S +     + LP  
Sbjct: 90  SENRSKFYESASARKRTVTAEERERAVNAAKTFEPTNPYFRVVLRPSYLYRGCIMYLPSG 149

Query: 592 EAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEG 651
            AE +L       GIS  ++     + W +R  +           +   +F   N + EG
Sbjct: 150 FAEKYL------SGISGFIKLQLGEKQWPVRCLYKAGRAKF---SQGWYEFTLENNIGEG 200

Query: 652 DFIVIYSDVKLIRGVKVRQPS 672
           D  V          ++V    
Sbjct: 201 DVCVFELLRTRDFVLEVTAFR 221


InterPro Results:

IPR003340 Family
PF02362 T[128-225] 8.8e-12 B3
Transcriptional factor B3
NULL
seg ?[66-77] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 89 1e-17
TF_22_1 ABI3/VP1FUSCA3 78 8e-15

TOP