AGI ID: At1g49475

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At1g49475
MRNMHTNRRS PGPITSAATQ RRLKPEPEPT VKKFIKIILL SRIIEKMMKV PARFVRFGPK
LTDNVTLQTP VGFKRSIRIK RIGDEVWFEK GWSEFAEAHS LSDGHFLFFH YEGDSCFRVV
IFDVSASEIE YPLDDTDDNR EEVMDDDEQG FTGFESSDDD GEVVDMDELL KKKKKKPRVN
IKSENVIILD DVEEIAMRSL EEEDLKKNLC KYVSPTKISA VPSSLNHIIV LRGNSCQAWQ
ELCSKNLANL
Length = 250 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At1g49475

>At1g49475 putative protein
          Length = 250

 Score = 83.8 bits (206), Expect = 3e-16
 Identities = 16/134 (11%), Positives = 43/134 (31%), Gaps = 10/134 (7%)

Query: 556 DRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGT 615
            +R+     +       K++  S +     + +P +      P+L               
Sbjct: 19  TQRRLKPEPEPTVKKFIKIILLSRIIEK-MMKVPARFV-RFGPKLTDN-----VTLQTPV 71

Query: 616 SRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQK 675
               ++R +   +    ++  +   +F + + L +G F+  + +      V +   S  +
Sbjct: 72  GFKRSIRIKRIGDE---VWFEKGWSEFAEAHSLSDGHFLFFHYEGDSCFRVVIFDVSASE 128

Query: 676 PEAPPSSAATKRQN 689
            E P       R+ 
Sbjct: 129 IEYPLDDTDDNREE 142


InterPro Results:

NULL
seg ?[171-176] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 84 3e-16

TOP