AGI ID: At1g49190

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative two-component response regulator gb|AAD12696.1

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At1g49190
MLVGKISGYE DNTRSLERET SEITSLLSQF PGNTNVLVVD TNFTTLLNMK QIMKQYAYQV
SIETDAEKAL AFLTSCKHEI NIVIWDFHMP GIDGLQALKS ITSKLDLPVV IMSDDNQTES
VMKATFYGAC DYVVKPVKEE VMANIWQHIV RKRLIFKPDV APPVQSDPAR SDRLDQVKAD
FKIVEDEPII NETPLITWTE EIQPVQSDLV QANKFDQVNG YSPIMNQDNM FNKAPPKPRM
TWTEVIQPVQ SNLVQTKEFG QLNDYSQIMN QDSMYNKAAT KPQLTWTEEI QPVQSGLVQA
NEFSKVNGYS QSMNQDSMFN KSATNPRLTW NELLQPVQSD LVQSNEFSQF SDYSQIMNED
NMFNKAAKKP RMTWSEVFQP VQSHLVPTDG LDRDHFDSIT INGGNGIQNM EKKQGKKPRK
PRMTWTEELH QKFLEAIEII GANPKVLVEC LQEMRIEGIT RSNVASHLQK HRINLEENQI
PQQTQGNGWA TAYGTLAPSL QGSDNVNTTI PSYLMNGPAT LNQIQQNQYQ NGFLTMNNNQ
IITNPPPPLP YLDHHHQQQH QSSPQFNYLM NNEELLQASG LSATDLELTY PSLPYDPQEY
LINGYNYN
Length = 608 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g49190

>At1g49190 putative two-component response regulator gb|AAD12696.1
          Length = 608

 Score = 89.3 bits (220), Expect = 8e-18
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 7/71 (9%)

Query: 176 MQPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKG---ILKLMGVDGLTIYHI 232
              ++    P K R+ WT ELH +F+ A+  +G    A PK     L+ M ++G+T  ++
Sbjct: 409 NMEKKQGKKPRKPRMTWTEELHQKFLEAIEIIG----ANPKVLVECLQEMRIEGITRSNV 464

Query: 233 KSHLQKYRLNI 243
            SHLQK+R+N+
Sbjct: 465 ASHLQKHRINL 475


InterPro Results:

IPR001005 Domain
PF00249 T[422-472] 2.3e-06 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[35-140] 2e-54 sp_Q9M9B9_ARATH_Q9M9B9;
PF00072 T[34-153] 7.3e-13 Response_reg
SM00448 T[34-145] 7.4e-16 REC
PS50110 T[35-150] 26.339 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[420-475] 2.7e-17 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[416-479] 1.5e-16 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[31-168] 2.3e-26 CheY-like
CheY-like
NULL
seg ?[545-565] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like 89 8e-18
TF_10_2 GARPARR-B class 84 1e-17
TF_1_2 MYB superfamilyLHY 73 4e-13
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 72 9e-13

TOP