AGI ID: At1g44830

TF ID:TF_68
Super family:ERF
Sub family:
Gene name: transcription factor, putative

Amino Acid Sequence:


1
61
121
181
>At1g44830
MVKTLQKTPK RMSSPSSSSS SSSSTSSSSI RMKKYKGVRM RSWGSWVSEI RAPNQKTRIW
LGSYSTAEAA ARAYDAALLC LKGSSANNLN FPEISTSLYH IINNGDNNND MSPKSIQRVA
AAAAAANTDP SSSSVSTSSP LLSSPSEDLY DVVSMSQYDQ QVSLSESSSW YNCFDGDDQF
MFINGVSAPY LTTSLSDDFF EEGDIRLWNF C
Length = 211 AA.

PSI BLAST Result:

Query: Query sequence of TF_68
Sbjct: At1g44830

>At1g44830 transcription factor, putative
          Length = 211

 Score = 88.0 bits (217), Expect = 3e-18
 Identities = 36/77 (46%), Positives = 47/77 (60%), Gaps = 2/77 (2%)

Query: 2   ASTTCAREVHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGI 61
            S++  R   Y+GVR R WG + +EIR P +KTR+WLG++ T E AA AYD A   L+G 
Sbjct: 25  TSSSSIRMKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYSTAEAAARAYDAALLCLKGS 84

Query: 62  KA-KTNFPSPLSLDLNH 77
            A   NFP  +S  L H
Sbjct: 85  SANNLNFPE-ISTSLYH 100


InterPro Results:

IPR001471 Domain
PD001423 T[41-66] 5e-09 sp_Q9LPE8_ARATH_Q9LPE8;
PR00367 T[35-46] 4.1e-10T[57-73] 4.1e-10 ETHRSPELEMNT
PF00847 T[33-97] 2.2e-30 AP2
SM00380 T[34-98] 2e-32 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[13-29]?[67-77]?[120-126]?[130-146] seg
SSF54171 T[33-94] 2e-19 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_68 ERF 88 3e-18
TF_2_5 AP2/EREBPDREB2A 85 6e-17
TF_2_4 AP2/EREBPCBF1 81 4e-16
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 82 5e-16
TF_65 Pti4 77 8e-15
TF_66 Pti5 74 4e-14
TF_2_3 AP2/EREBPAPETALA2 75 9e-14
TF_67 Pti6 73 1e-13
TF_2_2 AP2/EREBPAINTEGUMENTA 71 2e-12

TOP