AGI ID: At1g43950

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At1g43950
MESGNVVNVQ SELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGEKVYYFP QGHIELVEAS
TREELNELQP NCDLPSKLQC RVIAIHLKVE NNSDETYVEI TLMPDTTQVV IPTENENQFR
PIVNSFTKVL TASDTSAQGE FSVPCKHAIE CLPPLDMSQP IPAQELIAID LHGNQWRFKH
SYRDTTGWNA FTTSKKLVVG DVIVFARGET GELRVGIR
Length = 218 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g43950

>At1g43950 hypothetical protein
          Length = 218

 Score =  324 bits (830), Expect = 2e-88
 Identities = 91/228 (39%), Positives = 121/228 (52%), Gaps = 12/228 (5%)

Query: 30  QSTLLEEMKLLKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTR 89
              ++     L       K  +  +LW  CAGPL  +P++G  VYYF QGH E V  STR
Sbjct: 3   SGNVVNVQSELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVEASTR 62

Query: 90  RSATTQVPNYPNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLR 149
                  PN  +LPS+L C+V  + L  + +SDE Y +++L P  + + V P  +    R
Sbjct: 63  EELNELQPN-CDLPSKLQCRVIAIHLKVENNSDETYVEITLMPDTT-QVVIPTENENQFR 120

Query: 150 GSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWT 209
              +    F K LTASDTS  G FSVP + A +  PPLD S   P QEL+  DLH N W 
Sbjct: 121 PIVNS---FTKVLTASDTSAQGEFSVPCKHAIECLPPLDMSQPIPAQELIAIDLHGNQWR 177

Query: 210 FRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVR 257
           F+H YR        TTGW+ F  SK+L  GD ++F R E  +L VG+R
Sbjct: 178 FKHSYRD-------TTGWNAFTTSKKLVVGDVIVFARGETGELRVGIR 218


InterPro Results:

IPR008973 Domain
SSF49562 T[72-176] 1.3e-07 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5324 2e-88
TF_17_2 ARFNPH4/ARF7303 3e-82
TF_17_3 ARFETTIN/ARF3297 8e-81
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3123 4e-28
TF_22_1 ABI3/VP1FUSCA3109 2e-24

TOP