AGI ID: At1g35540

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor, putative

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At1g35540
MESGNVVNTQ PELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGEKVYYFP QGHIELVSSL
SLYSFSLLSL SLSLSLSLSL SLSLSLSPFS LFSLFSLSPL SLSLSLSLLL SHVEASTREE
LNELQPICDF PSKLQCRVIA IQLKVENNSD ETYAEITLMP DTTQVVIPTQ NQNQFRPLVN
SFTKVLTASD TSVHGGFSVP KKHAIECLPP LDMSQPLPTQ EILAIDLHGN QWRFRHIYRG
TAQRHLLTIG WNAFTTSKKL VEGDVIVFVR GETGELRVGI RRAGHQQGNI PSSIVSIESM
RHGIIASAKH AFDNQCMFIV VYKPRSSQFI VSYDKFLDVV NNKFNVGSRF TMRFEGDDFS
ERRSFGTIIG VSDFSPHWKC SEWRSLEVQW DEFASFPRPN QVSPWDIEHL TPWSNVSRSS
FLKNKRSREV NEIGSSSSHL LPPTLTQGQE IGQQSMATPM NISLRYRDIT EDAMTPSRLL
MSYPVQPMAK LNYNNVVTPI EENITTNAVA SFRLFGVSLA TPSVIKDPVE QIGLEISRLT
QEKKFGQSQI LRSPTEIQSK QFSSTRTCTK VQMQGVTIGR AVDLSVLNGY DQLILELEKL
FDLKGQLQAR NQWEIAFTNN EEDKMLVGED PWPEFCNMVK KIFIYSKEEV KNLKSRKSLS
S
Length = 661 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g35540

>At1g35540 auxin response factor, putative
          Length = 661

 Score =  584 bits (1505), Expect = e-167
 Identities = 155/485 (31%), Positives = 238/485 (48%), Gaps = 43/485 (8%)

Query: 83  QVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPV 142
            V  STR       P   + PS+L C+V  + L  + +SDE YA+++L P  + + V P 
Sbjct: 112 HVEASTREELNELQP-ICDFPSKLQCRVIAIQLKVENNSDETYAEITLMPDTT-QVVIPT 169

Query: 143 PDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRD 202
            +    R   +    F K LTASDTS HGGFSVP++ A +  PPLD S   PTQE++  D
Sbjct: 170 QNQNQFRPLVNS---FTKVLTASDTSVHGGFSVPKKHAIECLPPLDMSQPLPTQEILAID 226

Query: 203 LHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQ 262
           LH N W FRHIYRG  +RHLLT GW+ F  SK+L  GD ++F+R E  +L VG+RRA  Q
Sbjct: 227 LHGNQWRFRHIYRGTAQRHLLTIGWNAFTTSKKLVEGDVIVFVRGETGELRVGIRRAGHQ 286

Query: 263 QTALPSSVLSADSMHIGVLXXXXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQ 322
           Q  +PSS++S +SM  G++        N+  F++ Y PR+  ++F++   K+   +  ++
Sbjct: 287 QGNIPSSIVSIESMRHGIIASAKHAFDNQCMFIVVYKPRS--SQFIVSYDKFLDVV-NNK 343

Query: 323 LSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRV 382
            +VG RF M FE +D  +RR  GTI+G+SD  P  W  S+WR+L+V+WDE     +P +V
Sbjct: 344 FNVGSRFTMRFEGDDFSERRSFGTIIGVSDFSP-HWKCSEWRSLEVQWDEFASFPRPNQV 402

Query: 383 SPWDIETPESLFIFPSLTS-------------GLKRQLHPSYFAGETEWGSLIKRPLIRV 429
           SPWDIE           +                   L P       E G       + +
Sbjct: 403 SPWDIEHLTPWSNVSRSSFLKNKRSREVNEIGSSSSHLLPPTLTQGQEIGQQSMATPMNI 462

Query: 430 PDSANGIMPYASFPS--MASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNG---GLLGD 484
                 I   A  PS  + S  +  M    +NN      ++ +++NI         L G 
Sbjct: 463 SLRYRDITEDAMTPSRLLMSYPVQPMAKLNYNN-----VVTPIEENITTNAVASFRLFGV 517

Query: 485 MKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSG---CS 541
                 ++ +   ++    ++LT          ++   SQ + +P + ++   S    C+
Sbjct: 518 SLATPSVIKDPVEQIGLEISRLTQE--------KKFGQSQILRSPTEIQSKQFSSTRTCT 569

Query: 542 SGRVQ 546
             ++Q
Sbjct: 570 KVQMQ 574



 Score =  157 bits (398), Expect = 2e-38
 Identities = 66/300 (22%), Positives = 115/300 (38%), Gaps = 55/300 (18%)

Query: 631 PFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMSN--- 687
             I+   D S       +        WD   +  + +Q SP   + L    N+  S+   
Sbjct: 366 GTIIGVSDFSP--HWKCSEWRSLEVQWDEFASFPRPNQVSPWDIEHLTPWSNVSRSSFLK 423

Query: 688 -----------STTSNILDPPLSNTV------LDDFCAIKD-----TDFQNHPSGCL--- 722
                      S++S++L P L+         +     I       T+    PS  L   
Sbjct: 424 NKRSREVNEIGSSSSHLLPPTLTQGQEIGQQSMATPMNISLRYRDITEDAMTPSRLLMSY 483

Query: 723 -------VGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNXXXXXXXXXNVDFDDCS- 774
                  +  NN      ++  IT+ + A  + F       +          ++    + 
Sbjct: 484 PVQPMAKLNYNNVVTP--IEENITTNAVASFRLFGVSLATPSVIKDPVEQIGLEISRLTQ 541

Query: 775 ---------LRQNSKGSSWQKIATPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIE 824
                    LR  ++  S Q  +T   RT TKVQ  G ++GR++D++    Y++L   +E
Sbjct: 542 EKKFGQSQILRSPTEIQSKQFSST---RTCTKVQMQGVTIGRAVDLSVLNGYDQLILELE 598

Query: 825 CMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEE 884
            +F L+G L     + W++ + + E D +LVG+DPW EF   V+ I I S  EV+ +   
Sbjct: 599 KLFDLKGQLQA--RNQWEIAFTNNEEDKMLVGEDPWPEFCNMVKKIFIYSKEEVKNLKSR 656


InterPro Results:

IPR001452 Domain
SSF50044 T[232-299] 0.0022 SH3-domain
SH3
IPR003340 Family
PF02362 T[181-286] 1.2e-05 B3
Transcriptional factor B3
IPR008973 Domain
SSF49562 T[128-168] 0.00011 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[308-387] 3.3e-49 Auxin_resp
Auxin response factor
NULL
seg ?[58-111]?[435-438] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5584 e-167
TF_17_3 ARFETTIN/ARF3514 e-146
TF_17_2 ARFNPH4/ARF7245 8e-65
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3154 2e-37
TF_55 Aux/IAA138 3e-33
TF_22_1 ABI3/VP1FUSCA3124 6e-29

TOP