AGI ID: At1g35520

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor, putative

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At1g35520
METGNVVNAQ PELSGIIDRS KSYMYEQLWK LCAGPLCDIP KLGEKVYYFP QGNIELVEAS
TREELNELQP ICDLPSKLQC RVIAIHLKVE NNSDETYAKI TLMPDTTQVV IPTQNENQFR
PLVNSFTKVL TASDISANGV FSVPKKHAIE CLPPLDMSQP LPAQELLAID LHGNQWSFRH
SYRGTPQRHL LTTGWNEFTT SKKLVKGDVI VFVRGETGEL RVGIRRARHQ QGNIPSSIVS
IDCMRHGVIA SAKHAFDNQC MFIVVYKPRS SQFIVSYDKF LDAVNNKFNV GSRFTMRFEG
DDLSERRYFG TIIGVSNFSP HWKCSDWRSL EWDEFASFLR PNKVSPWEIE HLMPALNVPR
SSFLKNKRLR EVNEFGSSSS HLLPPILTQG QEIGQLSVAS PMNISLLYRE TTEDAMNPSR
LLMSYPVQPM PKRNYNNQMV TQIEENITTK AGTNFRLFGV SLATPPVIKD PIEQIGSDIS
KLTEGKKFGQ SQTLRSPTKI QSKQFSSTRT CTKVQMQGVT IGRAVDLSVL NGYDQLILEL
EKLFDLKGQL QTRNQWKIIF TGSDEDEMLV GDDPWP
Length = 576 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g35520

>At1g35520 auxin response factor, putative
          Length = 576

 Score =  687 bits (1773), Expect = 0.0
 Identities = 180/520 (34%), Positives = 266/520 (50%), Gaps = 44/520 (8%)

Query: 48  KPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLM 107
           K  +  +LW  CAGPL  +P++G  VYYF QG+ E V  STR       P   +LPS+L 
Sbjct: 21  KSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGNIELVEASTREELNELQP-ICDLPSKLQ 79

Query: 108 CQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDT 167
           C+V  + L  + +SDE YA+++L P  + + V P  +    R   +    F K LTASD 
Sbjct: 80  CRVIAIHLKVENNSDETYAKITLMPDTT-QVVIPTQNENQFRPLVNS---FTKVLTASDI 135

Query: 168 STHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGW 227
           S +G FSVP++ A +  PPLD S   P QEL+  DLH N W+FRH YRG P+RHLLTTGW
Sbjct: 136 SANGVFSVPKKHAIECLPPLDMSQPLPAQELLAIDLHGNQWSFRHSYRGTPQRHLLTTGW 195

Query: 228 SLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXXXXXX 287
           + F  SK+L  GD ++F+R E  +L VG+RRA  QQ  +PSS++S D M  GV+      
Sbjct: 196 NEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVIASAKHA 255

Query: 288 XXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTI 347
             N+  F++ Y PR+  ++F++   K+  A+  ++ +VG RF M FE +D  +RRY GTI
Sbjct: 256 FDNQCMFIVVYKPRS--SQFIVSYDKFLDAV-NNKFNVGSRFTMRFEGDDLSERRYFGTI 312

Query: 348 VGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSL-------- 399
           +G+S+  P  W  S WR+L+  WDE     +P +VSPW+IE        P          
Sbjct: 313 IGVSNFSP-HWKCSDWRSLE--WDEFASFLRPNKVSPWEIEHLMPALNVPRSSFLKNKRL 369

Query: 400 -----TSGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPS--MASEQLMK 452
                       L P       E G L     + +          A  PS  + S  +  
Sbjct: 370 REVNEFGSSSSHLLPPILTQGQEIGQLSVASPMNISLLYRETTEDAMNPSRLLMSYPVQP 429

Query: 453 MMMRPHNNQNVPSFMSEMQQNIVMGNGG---LLGDMKMQQPLMMNQKSEMVQPQNKLTVN 509
           M  R +NNQ V    +++++NI    G    L G      P++ +   ++    +KL   
Sbjct: 430 MPKRNYNNQMV----TQIEENITTKAGTNFRLFGVSLATPPVIKDPIEQIGSDISKL--- 482

Query: 510 PSASNTSGQEQNLSQSMSAPAKPENSTLSG---CSSGRVQ 546
                T G++   SQ++ +P K ++   S    C+  ++Q
Sbjct: 483 -----TEGKKFGQSQTLRSPTKIQSKQFSSTRTCTKVQMQ 517



 Score =  129 bits (324), Expect = 8e-30
 Identities = 55/250 (22%), Positives = 97/250 (38%), Gaps = 50/250 (20%)

Query: 657 WDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTTSNIL---------DPPLSNTVLDD-- 705
           WD   + L+ ++ SP   + L  + N+  S+   +  L            L   +L    
Sbjct: 332 WDEFASFLRPNKVSPWEIEHLMPALNVPRSSFLKNKRLREVNEFGSSSSHLLPPILTQGQ 391

Query: 706 ---------FCAI-----KDTDFQNHPSGCLVG---------NNNTSFAQDVQSQITSAS 742
                       I     + T+   +PS  L+          N N      ++  IT+ +
Sbjct: 392 EIGQLSVASPMNISLLYRETTEDAMNPSRLLMSYPVQPMPKRNYNNQMVTQIEENITTKA 451

Query: 743 FADSQAFS--------RQDFPDNXXXXXXXXXNVDF--DDCSLRQNSKGSSWQKIATPRV 792
             + + F          +D  +                   +LR  +K  S Q  +T   
Sbjct: 452 GTNFRLFGVSLATPPVIKDPIEQIGSDISKLTEGKKFGQSQTLRSPTKIQSKQFSST--- 508

Query: 793 RTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESD 851
           RT TKVQ  G ++GR++D++    Y++L   +E +F L+G L     + WK+++   + D
Sbjct: 509 RTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQL--QTRNQWKIIFTGSDED 566

Query: 852 VLLVGDDPWE 861
            +LVGDDPW 
Sbjct: 567 EMLVGDDPWP 576


InterPro Results:

IPR001452 Domain
SSF50044 T[186-242] 0.0035 SH3-domain
SH3
IPR003340 Family
PF02362 T[125-230] 1.2e-05 B3
Transcriptional factor B3
IPR008973 Domain
SSF49562 T[72-173] 9.8e-06 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[252-331] 1.1e-47 Auxin_resp
Auxin response factor

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5687 0.0
TF_17_2 ARFNPH4/ARF7603 e-172
TF_17_3 ARFETTIN/ARF3569 e-162
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3153 4e-37
TF_22_1 ABI3/VP1FUSCA3124 6e-29
TF_55 Aux/IAA105 2e-23

TOP