AGI ID: At1g35240

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At1g35240
METGNVVNAQ PELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGENVYYFP QGNIELVDAS
TREELNELQP ICDLPSKLQC RVIAIHLKVE NNSDETYAEI TLMPDTTQVV IPTQSENQFR
PLVNSFTKVL TASDTSAYGG FFVPKKHAIE CLPPLDMSQP LPAQELLAKD LHGNQWRFRH
SYRGTPQRHS LTTGWNEFTT SKKLVKGDVI VFVRGETGEL RVGIRRARHQ QGNIPSSIVS
IDCMRHGVIA SAKHALDNQC IFIVVYKPRS SQFIVSYDKF LDAMNNKFIV GSRFTMRFEG
DDFSERRYFG TIIGVNDFSP HWKCSEWRSL EVQWDEFASF SRPNKVSPWE IEHLMSALNV
PRSSLLKNKR LRETLEYLLN ILVLYTCSSS SHILPPILTQ GQEIGQLSVA SPMNTSLRYR
DTTEDAMNPS RLLMSYPVQP MPKLNYNNQM VTQIEENITT KAVTNFRLFG VSLAIPLVIK
DPIEEIGSDI SKLTEGKKFG QSQTLRSPIE IQSKQFGSTR TCTKVQMQGV TIGRAVDLSV
LNGYDQLILE LEKLFDLKGQ LQTRNQWKIA FTDSDGYEML VGDDPWPEFC KMVKKILIYS
KEEVKNLKSS KSLSS
Length = 615 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g35240

>At1g35240 hypothetical protein
          Length = 615

 Score =  695 bits (1795), Expect = 0.0
 Identities = 177/529 (33%), Positives = 264/529 (49%), Gaps = 51/529 (9%)

Query: 48  KPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLM 107
           K  +  +LW  CAGPL  +P++G  VYYF QG+ E V  STR       P   +LPS+L 
Sbjct: 21  KSYMYEQLWKLCAGPLCDIPKLGENVYYFPQGNIELVDASTREELNELQP-ICDLPSKLQ 79

Query: 108 CQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDT 167
           C+V  + L  + +SDE YA+++L P  + + V P       R   +    F K LTASDT
Sbjct: 80  CRVIAIHLKVENNSDETYAEITLMPDTT-QVVIPTQSENQFRPLVNS---FTKVLTASDT 135

Query: 168 STHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGW 227
           S +GGF VP++ A +  PPLD S   P QEL+ +DLH N W FRH YRG P+RH LTTGW
Sbjct: 136 SAYGGFFVPKKHAIECLPPLDMSQPLPAQELLAKDLHGNQWRFRHSYRGTPQRHSLTTGW 195

Query: 228 SLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXXXXXX 287
           + F  SK+L  GD ++F+R E  +L VG+RRA  QQ  +PSS++S D M  GV+      
Sbjct: 196 NEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVIASAKHA 255

Query: 288 XXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTI 347
             N+  F++ Y PR+  ++F++   K+  A+  ++  VG RF M FE +D  +RRY GTI
Sbjct: 256 LDNQCIFIVVYKPRS--SQFIVSYDKFLDAM-NNKFIVGSRFTMRFEGDDFSERRYFGTI 312

Query: 348 VGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLT------- 400
           +G++D  P  W  S+WR+L+V+WDE     +P +VSPW+IE   S    P  +       
Sbjct: 313 IGVNDFSP-HWKCSEWRSLEVQWDEFASFSRPNKVSPWEIEHLMSALNVPRSSLLKNKRL 371

Query: 401 ---------------SGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPS- 444
                                + P       E G L     +            A  PS 
Sbjct: 372 RETLEYLLNILVLYTCSSSSHILPPILTQGQEIGQLSVASPMNTSLRYRDTTEDAMNPSR 431

Query: 445 -MASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGG---LLGDMKMQQPLMMNQKSEMV 500
            + S  +  M    +NNQ V    +++++NI         L G       ++ +   E+ 
Sbjct: 432 LLMSYPVQPMPKLNYNNQMV----TQIEENITTKAVTNFRLFGVSLAIPLVIKDPIEEIG 487

Query: 501 QPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSG---CSSGRVQ 546
              +KL        T G++   SQ++ +P + ++        C+  ++Q
Sbjct: 488 SDISKL--------TEGKKFGQSQTLRSPIEIQSKQFGSTRTCTKVQMQ 528



 Score =  150 bits (379), Expect = 3e-36
 Identities = 62/278 (22%), Positives = 104/278 (37%), Gaps = 59/278 (21%)

Query: 657 WDTQLNGLKFDQFSPLMQQDLYASQNICMSN-----------STTSNIL-------DPPL 698
           WD   +  + ++ SP   + L ++ N+  S+               NIL          +
Sbjct: 334 WDEFASFSRPNKVSPWEIEHLMSALNVPRSSLLKNKRLRETLEYLLNILVLYTCSSSSHI 393

Query: 699 SNTVLDDFCAIKD----------------TDFQNHPSGCLVG---------NNNTSFAQD 733
              +L     I                  T+   +PS  L+          N N      
Sbjct: 394 LPPILTQGQEIGQLSVASPMNTSLRYRDTTEDAMNPSRLLMSYPVQPMPKLNYNNQMVTQ 453

Query: 734 VQSQITSASFADSQAFSRQ-DFPDNXXXXXXXXXNVDFD---------DCSLRQNSKGSS 783
           ++  IT+ +  + + F      P           +               +LR   +  S
Sbjct: 454 IEENITTKAVTNFRLFGVSLAIPLVIKDPIEEIGSDISKLTEGKKFGQSQTLRSPIEIQS 513

Query: 784 WQKIATPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWK 842
            Q  +T   RT TKVQ  G ++GR++D++    Y++L   +E +F L+G L     + WK
Sbjct: 514 KQFGST---RTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQL--QTRNQWK 568

Query: 843 LVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQ 880
           + + D +   +LVGDDPW EF   V+ I I S  EV+ 
Sbjct: 569 IAFTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKN 606


InterPro Results:

IPR001452 Domain
SSF50044 T[176-242] 0.0021 SH3-domain
SH3
IPR003340 Family
PF02362 T[125-230] 8.8e-07 B3
Transcriptional factor B3
IPR008973 Domain
SSF49562 T[72-115] 2.1e-05 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[252-331] 9.2e-52 Auxin_resp
Auxin response factor
NULL
seg ?[600-615] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5695 0.0
TF_17_2 ARFNPH4/ARF7615 e-176
TF_17_3 ARFETTIN/ARF3572 e-163
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3151 1e-36
TF_55 Aux/IAA131 4e-31
TF_22_1 ABI3/VP1FUSCA3123 1e-28

TOP