AGI ID: At1g34410

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor, putative

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At1g34410
MDDLSESNCR NHASEDKAWR KIMCFCSAVD GSKSYMYEQL WKLCAGPLCD IPKLGENVYY
FPQGNIELVQ ASTREELNEL QPICDLPSKL QCRVIAIHLK VENNSDEIYA EITLMPDTTQ
VVIPTQSENR FRPLVNSFTK VLTASDTSAY GGFSVPKKHA IECLPPLDMS QPLPAQEILA
IDLHDNQWRF RHNYRGTPQR HSLTTGWNEF ITSKKLVKGD VIVFVRGETG ELRVGIRRAR
HQQGNIPSSI VSIDCMRHGV IASAKHAFDN QCIFIVVYKP SIRSSQFIVS YDKFLDAVNN
KFNVGSRFTM RFEGDDFSER RYFGTIIGVS DFSPHWKCSE WRSLEVQWDE FASFSRPNKV
SPWEIEHLVP ALNVPRSSLL KNKRLREVNE FGSSSSHLLP PILTQGQEIG QLSVASPMNI
SLRYRDTTEA AMNPSRLLMS YPVQPMPKLN YNNQMVTQIE ENITTKAGTN FRLFGVTLDT
PPMIKDPIKQ IGSDISKLTE RKKFGQSQTL RSPIEIQSKQ FSSSRTCTKV QMQGVTIGRA
VDLSVLNGYD QLILELEKLF DIKGQLQTRN QWKIAFTDSD GYEMLVGDDP WPEFCKMVKK
ILIYSKEEVK NLKSSKSLSS
Length = 620 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g34410

>At1g34410 auxin response factor, putative
          Length = 620

 Score =  700 bits (1807), Expect = 0.0
 Identities = 179/520 (34%), Positives = 267/520 (50%), Gaps = 40/520 (7%)

Query: 48  KPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLM 107
           K  +  +LW  CAGPL  +P++G  VYYF QG+ E V  STR       P   +LPS+L 
Sbjct: 33  KSYMYEQLWKLCAGPLCDIPKLGENVYYFPQGNIELVQASTREELNELQP-ICDLPSKLQ 91

Query: 108 CQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDT 167
           C+V  + L  + +SDEIYA+++L P  + + V P       R   +    F K LTASDT
Sbjct: 92  CRVIAIHLKVENNSDEIYAEITLMPDTT-QVVIPTQSENRFRPLVNS---FTKVLTASDT 147

Query: 168 STHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGW 227
           S +GGFSVP++ A +  PPLD S   P QE++  DLH+N W FRH YRG P+RH LTTGW
Sbjct: 148 SAYGGFSVPKKHAIECLPPLDMSQPLPAQEILAIDLHDNQWRFRHNYRGTPQRHSLTTGW 207

Query: 228 SLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXXXXXX 287
           + F+ SK+L  GD ++F+R E  +L VG+RRA  QQ  +PSS++S D M  GV+      
Sbjct: 208 NEFITSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVIASAKHA 267

Query: 288 XXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTI 347
             N+  F++ Y P    ++F++   K+  A+  ++ +VG RF M FE +D  +RRY GTI
Sbjct: 268 FDNQCIFIVVYKPSIRSSQFIVSYDKFLDAV-NNKFNVGSRFTMRFEGDDFSERRYFGTI 326

Query: 348 VGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSL-------- 399
           +G+SD  P  W  S+WR+L+V+WDE     +P +VSPW+IE        P          
Sbjct: 327 IGVSDFSP-HWKCSEWRSLEVQWDEFASFSRPNKVSPWEIEHLVPALNVPRSSLLKNKRL 385

Query: 400 -----TSGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPS--MASEQLMK 452
                       L P       E G L     + +          A  PS  + S  +  
Sbjct: 386 REVNEFGSSSSHLLPPILTQGQEIGQLSVASPMNISLRYRDTTEAAMNPSRLLMSYPVQP 445

Query: 453 MMMRPHNNQNVPSFMSEMQQNIVMGNGG---LLGDMKMQQPLMMNQKSEMVQPQNKLTVN 509
           M    +NNQ V    +++++NI    G    L G      P++ +   ++    +KL   
Sbjct: 446 MPKLNYNNQMV----TQIEENITTKAGTNFRLFGVTLDTPPMIKDPIKQIGSDISKL--- 498

Query: 510 PSASNTSGQEQNLSQSMSAPAKPENSTLSG---CSSGRVQ 546
                T  ++   SQ++ +P + ++   S    C+  ++Q
Sbjct: 499 -----TERKKFGQSQTLRSPIEIQSKQFSSSRTCTKVQMQ 533



 Score =  157 bits (398), Expect = 2e-38
 Identities = 63/295 (21%), Positives = 108/295 (36%), Gaps = 52/295 (17%)

Query: 631 PFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTT 690
             I+   D S       +        WD   +  + ++ SP   + L  + N+  S+   
Sbjct: 324 GTIIGVSDFSP--HWKCSEWRSLEVQWDEFASFSRPNKVSPWEIEHLVPALNVPRSSLLK 381

Query: 691 SNIL---------DPPLSNTVLDDFCAIKD----------------TDFQNHPSGCLVG- 724
           +  L            L   +L     I                  T+   +PS  L+  
Sbjct: 382 NKRLREVNEFGSSSSHLLPPILTQGQEIGQLSVASPMNISLRYRDTTEAAMNPSRLLMSY 441

Query: 725 --------NNNTSFAQDVQSQITSASFADSQAFS-RQDFPDNXXXXXXXXXNVDFD---- 771
                   N N      ++  IT+ +  + + F    D P           +        
Sbjct: 442 PVQPMPKLNYNNQMVTQIEENITTKAGTNFRLFGVTLDTPPMIKDPIKQIGSDISKLTER 501

Query: 772 -----DCSLRQNSKGSSWQKIATPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIEC 825
                  +LR   +  S Q  ++   RT TKVQ  G ++GR++D++    Y++L   +E 
Sbjct: 502 KKFGQSQTLRSPIEIQSKQFSSS---RTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEK 558

Query: 826 MFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQ 880
           +F ++G L     + WK+ + D +   +LVGDDPW EF   V+ I I S  EV+ 
Sbjct: 559 LFDIKGQL--QTRNQWKIAFTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKN 611


InterPro Results:

IPR001452 Domain
SSF50044 T[189-254] 0.0021 SH3-domain
SH3
IPR008973 Domain
SSF49562 T[84-188] 1.1e-06 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[264-345] 9.9e-49 Auxin_resp
Auxin response factor
NULL
seg ?[605-620] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5700 0.0
TF_17_2 ARFNPH4/ARF7611 e-175
TF_17_3 ARFETTIN/ARF3579 e-165
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3148 7e-36
TF_55 Aux/IAA133 9e-32
TF_22_1 ABI3/VP1FUSCA3121 6e-28

TOP