AGI ID: At1g34390

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor, putative

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At1g34390
MESGNIVNAQ PELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGEKIYYFP QGNIELVEAS
TREELNELKP ICDLPSKLQC RVIAIQLKVE NNSDETYAEI TLMPDTTQVV IPTQNENQFR
PLVNSFTKVL TASDTSGGFF VPKKHAIECL PPLDMSQPLP TQELLATDLH GNQWRFNHNY
RGTPQRHLLT TGWNAFTTSK KLVAGDVIVF VRGETGELRV GIRRAGHQQG NIPSSIISIE
SMRHGVIASA KHAFDNQCMF IVVYKPSIRS SQFIVSYDKF LDAVNNKFNV GSRFTMRFEG
DDFSERRYFG TIIGVSDFSP HWKCSEWRNL EVQWDEFASF SRPNKVSPWE IEHLMPALNV
PRPSLLKNKR LREVNEIGSS SSHLLPPILT QGQEIGQLSV ASPMNISLTY RDTTEDVMNP
SRLLMSYPVQ PMPKLNYNNQ MVTQIEENIT TKTGTNFRLF GVSLVTPSVI KDPIEEIGSE
ISKLTEGKKF GQSQTLRSPT EIQSKQFSST RTCTKVQMQG VTIERAVDLS VLNGYDQLIL
ELEELFDLKG QLQTRNQWEI AFTDSDDDKM LVGDDPWPEF CNMVKKILIF KRGGQKLEVQ
Length = 600 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g34390

>At1g34390 auxin response factor, putative
          Length = 600

 Score =  680 bits (1754), Expect = 0.0
 Identities = 180/520 (34%), Positives = 268/520 (50%), Gaps = 42/520 (8%)

Query: 48  KPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLM 107
           K  +  +LW  CAGPL  +P++G  +YYF QG+ E V  STR       P   +LPS+L 
Sbjct: 21  KSYMYEQLWKLCAGPLCDIPKLGEKIYYFPQGNIELVEASTREELNELKP-ICDLPSKLQ 79

Query: 108 CQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDT 167
           C+V  + L  + +SDE YA+++L P  + + V P  +    R   +    F K LTASDT
Sbjct: 80  CRVIAIQLKVENNSDETYAEITLMPDTT-QVVIPTQNENQFRPLVNS---FTKVLTASDT 135

Query: 168 STHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGW 227
           S  GGF VP++ A +  PPLD S   PTQEL+  DLH N W F H YRG P+RHLLTTGW
Sbjct: 136 S--GGFFVPKKHAIECLPPLDMSQPLPTQELLATDLHGNQWRFNHNYRGTPQRHLLTTGW 193

Query: 228 SLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXXXXXX 287
           + F  SK+L AGD ++F+R E  +L VG+RRA  QQ  +PSS++S +SM  GV+      
Sbjct: 194 NAFTTSKKLVAGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIISIESMRHGVIASAKHA 253

Query: 288 XXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTI 347
             N+  F++ Y P    ++F++   K+  A+  ++ +VG RF M FE +D  +RRY GTI
Sbjct: 254 FDNQCMFIVVYKPSIRSSQFIVSYDKFLDAV-NNKFNVGSRFTMRFEGDDFSERRYFGTI 312

Query: 348 VGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLT------- 400
           +G+SD  P  W  S+WRNL+V+WDE     +P +VSPW+IE        P  +       
Sbjct: 313 IGVSDFSP-HWKCSEWRNLEVQWDEFASFSRPNKVSPWEIEHLMPALNVPRPSLLKNKRL 371

Query: 401 ------SGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPS--MASEQLMK 452
                       L P       E G L     + +  +          PS  + S  +  
Sbjct: 372 REVNEIGSSSSHLLPPILTQGQEIGQLSVASPMNISLTYRDTTEDVMNPSRLLMSYPVQP 431

Query: 453 MMMRPHNNQNVPSFMSEMQQNIVMGNGG---LLGDMKMQQPLMMNQKSEMVQPQNKLTVN 509
           M    +NNQ V    +++++NI    G    L G   +   ++ +   E+    +KL   
Sbjct: 432 MPKLNYNNQMV----TQIEENITTKTGTNFRLFGVSLVTPSVIKDPIEEIGSEISKL--- 484

Query: 510 PSASNTSGQEQNLSQSMSAPAKPENSTLSG---CSSGRVQ 546
                T G++   SQ++ +P + ++   S    C+  ++Q
Sbjct: 485 -----TEGKKFGQSQTLRSPTEIQSKQFSSTRTCTKVQMQ 519



 Score =  145 bits (365), Expect = 1e-34
 Identities = 56/264 (21%), Positives = 99/264 (37%), Gaps = 50/264 (18%)

Query: 657 WDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTTSNIL---------DPPLSNTVLDDFC 707
           WD   +  + ++ SP   + L  + N+   +   +  L            L   +L    
Sbjct: 334 WDEFASFSRPNKVSPWEIEHLMPALNVPRPSLLKNKRLREVNEIGSSSSHLLPPILTQGQ 393

Query: 708 AIKD----------------TDFQNHPSGCLVG---------NNNTSFAQDVQSQITSAS 742
            I                  T+   +PS  L+          N N      ++  IT+ +
Sbjct: 394 EIGQLSVASPMNISLTYRDTTEDVMNPSRLLMSYPVQPMPKLNYNNQMVTQIEENITTKT 453

Query: 743 FADSQAFS--------RQDFPDNXXXXXXXXXNVDF--DDCSLRQNSKGSSWQKIATPRV 792
             + + F          +D  +                   +LR  ++  S Q  +T   
Sbjct: 454 GTNFRLFGVSLVTPSVIKDPIEEIGSEISKLTEGKKFGQSQTLRSPTEIQSKQFSST--- 510

Query: 793 RTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESD 851
           RT TKVQ  G ++ R++D++    Y++L   +E +F L+G L     + W++ + D + D
Sbjct: 511 RTCTKVQMQGVTIERAVDLSVLNGYDQLILELEELFDLKGQL--QTRNQWEIAFTDSDDD 568

Query: 852 VLLVGDDPWEEFVGCVRCIRILSP 875
            +LVGDDPW EF   V+ I I   
Sbjct: 569 KMLVGDDPWPEFCNMVKKILIFKR 592


InterPro Results:

IPR001452 Domain
SSF50044 T[184-241] 0.0051 SH3-domain
SH3
IPR003311 Family
PF02309 T[428-595] 0.0014 AUX_IAA
AUX/IAA protein
IPR003340 Family
PF02362 T[125-228] 4.4e-08 B3
Transcriptional factor B3
IPR008973 Domain
SSF49562 T[72-171] 5.8e-05 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[250-331] 1e-48 Auxin_resp
Auxin response factor

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5680 0.0
TF_17_2 ARFNPH4/ARF7612 e-175
TF_17_3 ARFETTIN/ARF3564 e-161
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3140 2e-33
TF_55 Aux/IAA128 2e-30
TF_22_1 ABI3/VP1FUSCA3118 3e-27

TOP