AGI ID: At1g34310

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At1g34310
MESGNVVNAQ PELSGIIDGS KSYVYEQLWK LCAGPLCDIP KLGEKVYYFP QGHIELVETS
TREELNELQP ICDLPSKLQC RVIAIHLKVE NNSDETYAEI TLMPDTTVSE NLQVVIPTQN
ENQFRPLVNS FTKVLTASDT SAHGGFFVPK KHAIECLPSL DMSQPLPAQE LLAIDLHGNQ
WRFNHNYRGT PQRHLLTTGW NAFTTSKKLV AGDVIVFVRG ETGELRVGIR RARHQQGNIP
SSIVSIDCMR HGVVASAKHA FDNQCMFTVV YKPSYDKFLD AVNNKFNVGS RFTMRLEGDD
FSERRCFGTI IGVSDFSPHW KCSEWRSLEV QWDEFTSFPG PKKVSPWDIE HLMPAINVPR
SFLLKNKRLR EVNEIGSSSS HLLPPILTQG QENEQLSVAS PMNISLRYRD ATEDAMNPSK
LLMSYPVQPM PKLNYNNQMV TEMEENITTK TGTNFRLFGV TLDTPPVIKD PIEEIGSEIS
KLTEGKKFGL SQTLRSPTEI QNKQFSSSRT CTKVQMQGVT IGRAVDLSVL NGYDQLILEL
EKLFDIKGQL QTRNQWEIAF TDSDEDKMLV GDDPWPEFCN MVKKIFIQKR R
Length = 591 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g34310

>At1g34310 hypothetical protein
          Length = 591

 Score =  678 bits (1749), Expect = 0.0
 Identities = 183/524 (34%), Positives = 256/524 (47%), Gaps = 52/524 (9%)

Query: 48  KPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLM 107
           K  +  +LW  CAGPL  +P++G  VYYF QGH E V  STR       P   +LPS+L 
Sbjct: 21  KSYVYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVETSTREELNELQP-ICDLPSKLQ 79

Query: 108 CQVHNVTLHADKDSDEIYAQMSLQPVHSE----RDVFPVPDFGMLRGSKHPTEFFCKTLT 163
           C+V  + L  + +SDE YA+++L P  +     + V P  +    R   +    F K LT
Sbjct: 80  CRVIAIHLKVENNSDETYAEITLMPDTTVSENLQVVIPTQNENQFRPLVNS---FTKVLT 136

Query: 164 ASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLL 223
           ASDTS HGGF VP++ A +  P LD S   P QEL+  DLH N W F H YRG P+RHLL
Sbjct: 137 ASDTSAHGGFFVPKKHAIECLPSLDMSQPLPAQELLAIDLHGNQWRFNHNYRGTPQRHLL 196

Query: 224 TTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXX 283
           TTGW+ F  SK+L AGD ++F+R E  +L VG+RRA  QQ  +PSS++S D M  GV+  
Sbjct: 197 TTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVVAS 256

Query: 284 XXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRY 343
                 N+  F + Y P            K+  A+  ++ +VG RF M  E +D  +RR 
Sbjct: 257 AKHAFDNQCMFTVVYKP---------SYDKFLDAV-NNKFNVGSRFTMRLEGDDFSERRC 306

Query: 344 MGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLT--- 400
            GTI+G+SD  P  W  S+WR+L+V+WDE      P +VSPWDIE        P      
Sbjct: 307 FGTIIGVSDFSP-HWKCSEWRSLEVQWDEFTSFPGPKKVSPWDIEHLMPAINVPRSFLLK 365

Query: 401 ----------SGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPS--MASE 448
                           L P       E   L     + +          A  PS  + S 
Sbjct: 366 NKRLREVNEIGSSSSHLLPPILTQGQENEQLSVASPMNISLRYRDATEDAMNPSKLLMSY 425

Query: 449 QLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGG---LLGDMKMQQPLMMNQKSEMVQPQNK 505
            +  M    +NNQ V    +EM++NI    G    L G      P++ +   E+    +K
Sbjct: 426 PVQPMPKLNYNNQMV----TEMEENITTKTGTNFRLFGVTLDTPPVIKDPIEEIGSEISK 481

Query: 506 LTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSG---CSSGRVQ 546
           L        T G++  LSQ++ +P + +N   S    C+  ++Q
Sbjct: 482 L--------TEGKKFGLSQTLRSPTEIQNKQFSSSRTCTKVQMQ 517



 Score =  148 bits (374), Expect = 1e-35
 Identities = 60/290 (20%), Positives = 109/290 (36%), Gaps = 52/290 (17%)

Query: 631 PFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMS---- 686
             I+   D S       +        WD   +     + SP   + L  + N+  S    
Sbjct: 308 GTIIGVSDFSP--HWKCSEWRSLEVQWDEFTSFPGPKKVSPWDIEHLMPAINVPRSFLLK 365

Query: 687 ----------NSTTSNILDPPLSNTVLDD------FCAIK-----DTDFQNHPSGCLVG- 724
                      S++S++L P L+    ++         I       T+   +PS  L+  
Sbjct: 366 NKRLREVNEIGSSSSHLLPPILTQGQENEQLSVASPMNISLRYRDATEDAMNPSKLLMSY 425

Query: 725 --------NNNTSFAQDVQSQITSASFADSQAFS----RQDF---PDNXXXXXXXXXNVD 769
                   N N     +++  IT+ +  + + F            P              
Sbjct: 426 PVQPMPKLNYNNQMVTEMEENITTKTGTNFRLFGVTLDTPPVIKDPIEEIGSEISKLTEG 485

Query: 770 FD---DCSLRQNSKGSSWQKIATPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIEC 825
                  +LR  ++  + Q  ++   RT TKVQ  G ++GR++D++    Y++L   +E 
Sbjct: 486 KKFGLSQTLRSPTEIQNKQFSSS---RTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEK 542

Query: 826 MFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSP 875
           +F ++G L     + W++ + D + D +LVGDDPW EF   V+ I I   
Sbjct: 543 LFDIKGQL--QTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFIQKR 590


InterPro Results:

IPR001452 Domain
SSF50044 T[191-247] 0.0088 SH3-domain
SH3
IPR003340 Family
PF02362 T[130-235] 6.1e-06 B3
Transcriptional factor B3
IPR008973 Domain
SSF49562 T[72-106] 6.4e-05 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[257-329] 4.7e-38 Auxin_resp
Auxin response factor

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5678 0.0
TF_17_2 ARFNPH4/ARF7598 e-171
TF_17_3 ARFETTIN/ARF3561 e-160
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3156 4e-38
TF_55 Aux/IAA133 7e-32
TF_22_1 ABI3/VP1FUSCA3124 4e-29

TOP