AGI ID: At1g34170

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At1g34170
MENNGEMNAQ PELSGIIDIT KTYMYEKLWN ICAGPLCVLP KPGEKVYYFP QGHIELIENS
TRDELDHIRP IFDLPSKLRC RVVAIDRKVD KNTDEVYAQI SLMPDTTDMS QPISTQNLVA
KDLYGQEWSF KHVFRGTPQR HMFTSGGGWS VFATTKRLIV GDIFVLLRGE NGELRFGIRR
AKHQQGHIPS SVISANCMQH GVIASVVNAF KTKCMFNVVY KPSYDKFVDA MNNNYIVGSR
FRMQFEGKDF SEKRYDGTII GVNDMSPHWK DSEWRSLKVQ WDELSPFLRP NQVSPWDIEH
LIPSSDISQS SATLSNLWTC QEIGQRSMNS PISVPEFSYP NAIEDSKFLS GLLLNHSLLA
IPNENYNSDQ MIQPRKEDIT TEATTSCLLF GVDLTKVHMQ GVAISRAVDL TAMHGYNQLI
QKLEELFDLK DELRTRNQWE IVFTNNEGAE MLVGDDPWPE FCNMAKRIFI CSKEEIKKMK
LKNKFFQPES KALTSSDVPP NVTDN
Length = 505 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g34170

>At1g34170 putative protein
          Length = 505

 Score =  479 bits (1232), Expect = e-135
 Identities = 131/452 (28%), Positives = 201/452 (43%), Gaps = 83/452 (18%)

Query: 45  GTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPS 104
              K  +  +LW+ CAGPL  LP+ G  VYYF QGH E +  STR       P + +LPS
Sbjct: 18  DITKTYMYEKLWNICAGPLCVLPKPGEKVYYFPQGHIELIENSTRDELDHIRPIF-DLPS 76

Query: 105 QLMCQVHNVTLHADKDSDEIYAQMSLQPVHSE-RDVFPVPDFGMLRGSKHPTEFFCKTLT 163
           +L C+V  +    DK++DE+YAQ+SL P  ++        +                   
Sbjct: 77  KLRCRVVAIDRKVDKNTDEVYAQISLMPDTTDMSQPISTQN------------------- 117

Query: 164 ASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLL 223
                                             LV +DL+   W+F+H++RG P+RH+ 
Sbjct: 118 ----------------------------------LVAKDLYGQEWSFKHVFRGTPQRHMF 143

Query: 224 TT--GWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVL 281
           T+  GWS+F  +KRL  GD  + +R E  +L  G+RRA  QQ  +PSSV+SA+ M  GV+
Sbjct: 144 TSGGGWSVFATTKRLIVGDIFVLLRGENGELRFGIRRAKHQQGHIPSSVISANCMQHGVI 203

Query: 282 XXXXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKR 341
                    +  F + Y P            K+  A+  + + VG RF M FE +D  ++
Sbjct: 204 ASVVNAFKTKCMFNVVYKP---------SYDKFVDAMNNNYI-VGSRFRMQFEGKDFSEK 253

Query: 342 RYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTS 401
           RY GTI+G++D+ P  W  S+WR+L+V+WDE     +P +VSPWDIE           ++
Sbjct: 254 RYDGTIIGVNDMSP-HWKDSEWRSLKVQWDELSPFLRPNQVSPWDIEHLIPSSDISQSSA 312

Query: 402 GLKRQLHPSYFAGETEWGSLIKRPLIRVPD-SANGIMPYASFPS--MASEQLMKMMMRPH 458
            L             E G       I VP+ S    +  + F S  + +  L+ +    +
Sbjct: 313 TLSNLWTC------QEIGQRSMNSPISVPEFSYPNAIEDSKFLSGLLLNHSLLAIPNENY 366

Query: 459 NNQNVPSFMSEMQQNIVMGNGG---LLGDMKM 487
           N+      +   +++I         L G    
Sbjct: 367 NSDQ---MIQPRKEDITTEATTSCLLFGVDLT 395



 Score =  219 bits (558), Expect = 6e-57
 Identities = 55/241 (22%), Positives = 97/241 (39%), Gaps = 48/241 (19%)

Query: 657 WDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTTSNI----------LDPPLSNTVLDDF 706
           WD     L+ +Q SP   + L  S +I  S++T SN+          ++ P+S       
Sbjct: 281 WDELSPFLRPNQVSPWDIEHLIPSSDISQSSATLSNLWTCQEIGQRSMNSPISVPEFSYP 340

Query: 707 CAIKDTDFQNHPSGCLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNXXXXXXXXX 766
            AI+D+ F    SG L+ ++  +        I + ++   Q                   
Sbjct: 341 NAIEDSKF---LSGLLLNHSLLA--------IPNENYNSDQMIQ---------------- 373

Query: 767 NVDFDDCSLRQNSKGSSWQKIATPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIEC 825
                    R+    +             TKV   G ++ R++D+T+   Y +L   +E 
Sbjct: 374 --------PRKEDITTEATTSCLLFGVDLTKVHMQGVAISRAVDLTAMHGYNQLIQKLEE 425

Query: 826 MFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEG 885
           +F L+  L     + W++V+ + E   +LVGDDPW EF    + I I S  E+++M  + 
Sbjct: 426 LFDLKDEL--RTRNQWEIVFTNNEGAEMLVGDDPWPEFCNMAKRIFICSKEEIKKMKLKN 483

Query: 886 M 886
            
Sbjct: 484 K 484


InterPro Results:

IPR001452 Domain
SSF50044 T[140-196] 0.011 SH3-domain
SH3
IPR008973 Domain
SSF49562 T[72-115] 0.0082 C2 domain (Calcium/lipid-binding domain, CaLB)
C2 calcium/lipid-binding region, CaLB
IPR010525 Domain
PF06507 T[206-278] 2.2e-39 Auxin_resp
Auxin response factor
NULL
coil ?[416-437] coiled-coil
seg ?[349-359]?[422-433]?[473-484] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5479 e-135
TF_17_2 ARFNPH4/ARF7439 e-123
TF_17_3 ARFETTIN/ARF3432 e-121
TF_55 Aux/IAA127 6e-30
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 85 1e-16
TF_22_1 ABI3/VP1FUSCA3 60 1e-09

TOP