AGI ID: At1g33760

TF ID:TF_2_4
Super family:AP2/EREBP
Sub family:CBF1
Gene name: TINY-like protein

Amino Acid Sequence:


1
61
121
181
>At1g33760
MENTYVGQRD YRFNVNQLSY RGIRRRKWGK WVSEIREPGK KTRIWLGSYE TAEMAAAAYD
AAALHLRGRG TNLNFPELVD SFPRPESSSS EHIQAAAQDA ALMFKPGRLS EPALESGQGL
SRVGLSPDQI QAINESPLDS PRMGWMQDLE VADYEELYGQ FFGQHDRDEF FEMQQFQSIW
NSNN
Length = 184 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_4
Sbjct: At1g33760

>At1g33760 TINY-like protein
          Length = 184

 Score =  123 bits (309), Expect = 7e-29
 Identities = 50/106 (47%), Positives = 61/106 (57%)

Query: 30  YRGIRRRNGDKWVCEVREPTHQRRIWLGTYPTADMAARAHDVAVLALRGRSACLNFADSA 89
           YRGIRRR   KWV E+REP  + RIWLG+Y TA+MAA A+D A L LRGR   LNF +  
Sbjct: 20  YRGIRRRKWGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDAAALHLRGRGTNLNFPELV 79

Query: 90  WRLPVPESNDPDVIRRVAAEAAEMFRPVDLESGITVLPCAGDDVDL 135
              P PES+  + I+  A +AA MF+P  L             V L
Sbjct: 80  DSFPRPESSSSEHIQAAAQDAALMFKPGRLSEPALESGQGLSRVGL 125


InterPro Results:

IPR001471 Domain
PD001423 T[26-51] 1e-09 sp_Q9LQ28_ARATH_Q9LQ28;
PR00367 T[20-31] 3.3e-11T[42-58] 3.3e-11 ETHRSPELEMNT
PF00847 T[18-81] 1.5e-36 AP2
SM00380 T[19-82] 1.7e-34 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[52-63] seg
SSF54171 T[18-79] 1.2e-22 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_4 AP2/EREBPCBF1123 7e-29
TF_2_2 AP2/EREBPAINTEGUMENTA103 2e-22
TF_65 Pti4 94 5e-20
TF_68 ERF 93 8e-20
TF_66 Pti5 90 6e-19
TF_2_5 AP2/EREBPDREB2A 91 9e-19
TF_2_3 AP2/EREBPAPETALA2 91 1e-18
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 87 1e-17
TF_67 Pti6 86 1e-17

TOP