AGI ID: At1g32240

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At1g32240
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSSLVSNS
TSKTINHPFQ DLSLSNISHH QQQQQHHHPQ LLPNCNSSNI LTSFQFPTQQ QQQHLQGFLA
HDLNTHLRPI RGIPLYHNPP PHHHPHRPPP PCFPFDPSSL IPSSSTSSPA LTGNNNSFNT
SSVSNPNYHN HHHQTLNRAR FMPRFPAKRS MRAPRMRWTT TLHARFVHAV ELLGGHERAT
PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDKAAASSGQ SDVYENGSSG DNNSDDWMFD
MNRKSRDSEE LTNPLEKSNG LWTNSSGEAR LHGKLIDNVA EIMLPSEKEL DGKCSSYERI
SSEEMSSSSI SGTSPFKPNL EFTLGRSH
Length = 388 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g32240

>At1g32240 unknown protein
          Length = 388

 Score =  116 bits (290), Expect = 5e-26
 Identities = 35/67 (52%), Positives = 43/67 (63%)

Query: 175 FMQPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKS 234
           FM    A       R+RWT  LH RFV+AV  LGG ++ATPK +L+LM V  LT+ H+KS
Sbjct: 201 FMPRFPAKRSMRAPRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKS 260

Query: 235 HLQKYRL 241
           HLQ YR 
Sbjct: 261 HLQMYRT 267


InterPro Results:

IPR001005 Domain
PF00249 T[215-266] 4.4e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[213-269] 9.7e-27 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[209-273] 3.5e-17 Homeodomain-like
Homeodomain-like
NULL
seg ?[51-64]?[79-88]?[104-118]?[134-169]?[174-187]?[355-374] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like116 5e-26
TF_10_2 GARPARR-B class 86 4e-18
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 61 1e-09
TF_1_2 MYB superfamilyLHY 58 2e-08

TOP