AGI ID: At1g32030

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g32030
MSTYYNDHLA AAEKDISSSN FCNLVDASVM LYDEEHRDLL PKKVNSRCQA KTKKQEKESD
KRFFDLFPKK RRTSVVTVRN PEQNQQNLHR VSTSSSLLDL NTIPGDSSDP RNELQGLLSS
SSSSFLGDYE RKTPQNASSS STLLAEYNTE MANPPNPNSE TSLKRKHSDS EPKKAKTPYS
WKGREAPEWL VKMMGTMQGS EGPRLIYEKT LTETDVKPVQ SRLLMPFNTL IRNDFLTPVE
LRILLELEDD TDGVGATLVD PWEVKWGVIL KKREMKKYSG KGSLNYAIIC GWNDIVEANV
LEKDDDISIW SFRRGRNGIL SFALVLPPPP DMA
Length = 333 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g32030

>At1g32030 hypothetical protein
          Length = 333

 Score =  108 bits (271), Expect = 2e-23
 Identities = 21/140 (15%), Positives = 37/140 (26%), Gaps = 19/140 (13%)

Query: 104 KYDRDALLASDMGLKLNRQPNEFFCKTLTASDTST-HGGFSVPRRAAEK--IFPA----- 155
           +   + L+     ++ +  P   + KTLT +D         +P     +           
Sbjct: 184 REAPEWLVKMMGTMQGSEGPRLIYEKTLTETDVKPVQSRLLMPFNTLIRNDFLTPVELRI 243

Query: 156 -LDFSMQPPCQELVAKDIHDNTWTFRHIYRGQPK-------RHLLTTGWSVFVSTKRLFA 207
            L+             D  +  W      R   K        + +  GW+  V    L  
Sbjct: 244 LLELEDDTDGVGATLVDPWEVKWGVILKKREMKKYSGKGSLNYAIICGWNDIVEANVLEK 303

Query: 208 GDSV---LFIRDGKAQLLLG 224
            D +    F R     L   
Sbjct: 304 DDDISIWSFRRGRNGILSFA 323


InterPro Results:

IPR005508 Domain
PF03754 T[184-298] 1.5e-72 DUF313
Protein of unknown function DUF313
NULL
seg ?[119-124] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7108 2e-23
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 99 4e-21
TF_22_1 ABI3/VP1FUSCA3 82 4e-16

TOP