AGI ID: At1g30330

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
>At1g30330
MRLSSAGFNP QPHEGEKRVL NSELWHACAG PLVSLPPVGS RVVYFPQGHS EQVAASTNKE
VDAHIPNYPS LHPQLICQLH NVTMHADVET DEVYAQMTLQ PLNAQEQKDP YLPAELGVPS
RQPTNYFCKT LTASDTSTHG GFSVPRRAAE KVFPPLDYSQ QPPAQELMAR DLHDNEWKFR
HIFRGQPKRH LLTTGWSVFV SAKRLVAGDS VLFIWNDKNQ LLLGIRRANR PQTVMPSSVL
SSDSMHLGLL AAAAHAAATN SRFTIFYNPR ASPSEFVIPL AKYVKAVYHT RVSVGMRFRM
LFETEESSVR RYMGTITGIC DLDPTRWANS HWRSVKVGWD ESTAGERQPR VSLWEIEPLT
TFPMYPSPFP LRLKRPWPPG LPSFHGLKED DMGMSMSSPL MWDRGLQSLN FQGMGVNPWM
QPRLDTSGLL GMQNDVYQAM AAAALQDMRG IDPAKAAASL LQFQNSPGFS MQSPSLVQPQ
MLQQQLSQQQ QQLSQQQQQQ QQLSQQQQQQ LSQQQQQQLS QQQQQQLSQQ QQQQAYLGVP
ETHQPQSQAQ SQSNNHLSQQ QQQVVDNHNP SASSAAVVSA MSQFGSASQP NTSPLQSMTS
LCHQQSFSDT NGGNNPISPL HTLLSNFSQD ESSQLLHLTR TNSAMTSSGW PSKRPAVDSS
FQHSGAGNNN TQSVLEQLGQ SHTSNVPPNA VSLPPFPGGR ECSIEQEGSA SDPHSHLLFG
VNIDSSSLLM PNGMSNLRSI GIEGGDSTTL PFTSSNFNND FSGNLAMTTP SSCIDESGFL
QSSENLGSEN PQSNTFVKVY KSGSFGRSLD ISKFSSYHEL RSELARMFGL EGQLEDPVRS
GWQLVFVDRE NDVLLLGDDP WPEFVSSVWC IKILSPQEVQ QMGKRGLELL NSAPSSNNVD
KLPSNGNCDD FGNRSDPRNL GNGIASVGGS FNY
Length = 933 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g30330

>At1g30330 putative protein
          Length = 933

 Score =  596 bits (1536), Expect = e-170
 Identities = 270/485 (55%), Positives = 327/485 (66%), Gaps = 22/485 (4%)

Query: 5   SSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQKQTD- 63
           SS G +P P EGE+R +NSELWHACAGPL+SLPP GS VVYFPQGHSEQVAAS  K+ D 
Sbjct: 4   SSAGFNPQPHEGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDA 63

Query: 64  FIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQP 123
            IP+YP+L  +LIC LHNVT++AD ETDEVYAQMTLQP+N  ++            +RQP
Sbjct: 64  HIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKDPYLPAELGVPSRQP 123

Query: 124 NEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFRHIY 183
             +FCKTLTASDTSTHGGFSVPRRAAEK+FP LD+S QPP QEL+A+D+HDN W FRHI+
Sbjct: 124 TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEWKFRHIF 183

Query: 184 RGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALXXXXXXXX 243
           RGQPKRHLLTTGWSVFVS KRL AGDSVLFI + K QLLLGIRRANR Q  +        
Sbjct: 184 RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPSSVLSSD 243

Query: 244 XMHIGVLXXXXXXXXXXSPFTIFYNPRWAAPAEFVVPLAKYTKAMYA-QVSLGMRFRMIF 302
            MH+G+L          S FTIFYNPR A+P+EFV+PLAKY KA+Y  +VS+GMRFRM+F
Sbjct: 244 SMHLGLLAAAAHAAATNSRFTIFYNPR-ASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLF 302

Query: 303 ETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVLTP 362
           ETEE  VRRYMGT+TGI DLDP RW NS WR++++GWDES AG+R  RVS+W+IEP+ T 
Sbjct: 303 ETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIEPL-TT 361

Query: 363 FYICPPPF-FRPRFSGQPGMP----DDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLS 417
           F + P PF  R +    PG+P      E DM  ++   + W       +   S  F G+ 
Sbjct: 362 FPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNFQGMG 415

Query: 418 LVQWMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDP--SKLLSFQTPHG-GI 474
           +  WM  +     L     Q   + +M    AAL +  G       + LL FQ   G  +
Sbjct: 416 VNPWMQPRLDTSGL--LGMQNDVYQAM--AAAALQDMRGIDPAKAAASLLQFQNSPGFSM 471

Query: 475 SSSNL 479
            S +L
Sbjct: 472 QSPSL 476



 Score =  287 bits (734), Expect = 3e-77
 Identities = 98/339 (28%), Positives = 159/339 (45%), Gaps = 56/339 (16%)

Query: 793  HQFPSSCTNNGLSTLQPPQMLVSRPQEKQNPPVGGGVKAYSGITDGGDAXXXXXXXXXXX 852
            HQ   S TN G + + P   L+S   + ++  +    +  S +T                
Sbjct: 603  HQQSFSDTNGGNNPISPLHTLLSNFSQDESSQLLHLTRTNSAMT---------------- 646

Query: 853  CQISSSGFLNRSQSGPAILIPDAAIDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDH 912
                SSG+ ++    PA+   D++   SG       + +   L+Q  +GQ  + +++  +
Sbjct: 647  ----SSGWPSKR---PAV---DSSFQHSGAG----NNNTQSVLEQ--LGQSHT-SNVPPN 689

Query: 913  QLEASASGTSYGLDGGENNRQQNFLAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYD 972
             +            G E + +Q       G   D  + LL G N+D+  +   L+  G  
Sbjct: 690  AVSLPP-----FPGGRECSIEQE------GSASDPHSHLLFGVNIDSSSL---LMPNGMS 735

Query: 973  SQKDLQNMLSNYGGVTNDIGTEMSTSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLW-P 1031
            + +          G+     T +  ++    +    N+   +    ++++G L       
Sbjct: 736  NLRS--------IGIEGGDSTTLPFTSSNFNNDFSGNLAMTTPSSCIDESGFLQSSENLG 787

Query: 1032 AQTQRMRTYTKVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYV 1091
            ++  +  T+ KV K GS GRS+D++++  Y ELR +LARMFG+EGQLEDP  S W+LV+V
Sbjct: 788  SENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFV 847

Query: 1092 DHENDILLVGDDPWEEFVNCVQSIKILSSAEVQQMSLDG 1130
            D END+LL+GDDPW EFV+ V  IKILS  EVQQM   G
Sbjct: 848  DRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRG 886


InterPro Results:

IPR003340 Family
PF02362 T[126-231] 1.2e-22 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[253-336] 2.2e-55 Auxin_resp
Auxin response factor
NULL
coil ?[483-534] coiled-coil
seg ?[251-258]?[472-534]?[544-563]?[571-580] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7596 e-170
TF_17_1 ARFMONOPTEROS/ARF5584 e-167
TF_17_3 ARFETTIN/ARF3526 e-149
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3146 3e-35
TF_22_1 ABI3/VP1FUSCA3122 2e-28
TF_55 Aux/IAA119 1e-27

TOP