AGI ID: At1g28370

TF ID:TF_68
Super family:ERF
Sub family:
Gene name: putative ethylene responsive element binding factor 4 ...

Amino Acid Sequence:


1
61
121
>At1g28370
MAPTVKTAAV KTNEGNGVRY RGVRKRPWGR YAAEIRDPFK KSRVWLGTFD TPEEAARAYD
KRAIEFRGAK AKTNFPCYNI NAHCLSLTQS LSQSSTVESS FPNLNLGSDS VSSRFPFPKI
QVKAGMMVFD ERSESDSSSV VMDVVRYEGR RVVLDLDLNF PPPPEN
Length = 166 AA.

PSI BLAST Result:

Query: Query sequence of TF_68
Sbjct: At1g28370

>At1g28370 putative ethylene responsive element binding factor 4 protein
          Length = 166

 Score =  120 bits (301), Expect = 4e-28
 Identities = 48/58 (82%), Positives = 50/58 (85%)

Query: 11 HYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFP 68
           YRGVRKRPWGRYAAEIRDP+KK+RVWLGTFDTPEEAA AYD  A   RG KAKTNFP
Sbjct: 19 RYRGVRKRPWGRYAAEIRDPFKKSRVWLGTFDTPEEAARAYDKRAIEFRGAKAKTNFP 76


InterPro Results:

IPR001471 Domain
PD001423 T[26-63] 1e-16 sp_Q9SGN4_ARATH_Q9SGN4;
PR00367 T[20-31] 2.2e-12T[42-58] 2.2e-12 ETHRSPELEMNT
PF00847 T[18-81] 3.2e-37 AP2
SM00380 T[19-82] 5.8e-34 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[85-100]?[128-146] seg
SSF54171 T[18-78] 4.7e-24 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_68 ERF120 4e-28
TF_67 Pti6120 6e-28
TF_2_4 AP2/EREBPCBF1117 5e-27
TF_2_3 AP2/EREBPAPETALA2114 1e-25
TF_2_2 AP2/EREBPAINTEGUMENTA113 2e-25
TF_66 Pti5 96 1e-20
TF_2_5 AP2/EREBPDREB2A 96 2e-20
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 95 7e-20
TF_65 Pti4 79 2e-15

TOP