AGI ID: At1g28300

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: VP1 protein, putative

Amino Acid Sequence:


1
61
121
181
241
301
361
>At1g28300
MDNFLPFPSS NANSVQELSM DPNNNRSHFT TVPTYDHHQA QPHHFLPPFS YPVEQMAAVM
NPQPVYLSEC YPQIPVTQTG SEFGSLVGNP CLWQERGGFL DPRMTKMARI NRKNAMMRSR
NNSSPNSSPS ELVDSKRQLM MLNLKNNVQI SDKKDSYQQS TFDNKKLRVL CEKELKNSDV
GSLGRIVLPK RDAEANLPKL SDKEGIVVQM RDVFSMQSWS FKYKFWSNNK SRMYVLENTG
EFVKQNGAEI GDFLTIYEDE SKNLYFAMNG NSGKQNEGRE NESRERNHYE EAMLDYIPRD
EEEASIAMLI GNLNDHYPIP NDLMDLTTDL QHHQATSSSM PPEDHAYVGS SDDQVSFNDF
EWW
Length = 363 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At1g28300

>At1g28300 VP1 protein, putative
          Length = 363

 Score =  128 bits (322), Expect = 1e-29
 Identities = 59/131 (45%), Positives = 84/131 (64%)

Query: 559 QGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRV 618
           Q     K LR L +K LK SDVG+LGRIVLPK++AE +LP+L  ++GI + M D+ + + 
Sbjct: 159 QSTFDNKKLRVLCEKELKNSDVGSLGRIVLPKRDAEANLPKLSDKEGIVVQMRDVFSMQS 218

Query: 619 WNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQKPEA 678
           W+ +Y+FW NNKSRMY+LENTG+FVK NG + GDF+ IY D        +   SG++ E 
Sbjct: 219 WSFKYKFWSNNKSRMYVLENTGEFVKQNGAEIGDFLTIYEDESKNLYFAMNGNSGKQNEG 278

Query: 679 PPSSAATKRQN 689
             + +  +   
Sbjct: 279 RENESRERNHY 289


InterPro Results:

IPR003340 Family
PF02362 T[170-273] 9.3e-10 B3
Transcriptional factor B3
NULL
seg ?[118-130]?[276-287] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3128 1e-29
TF_17_3 ARFETTIN/ARF3116 3e-26
TF_22_1 ABI3/VP1FUSCA3107 1e-23
TF_17_1 ARFMONOPTEROS/ARF5108 2e-23
TF_17_2 ARFNPH4/ARF7 90 8e-18

TOP