AGI ID: At1g26680

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
>At1g26680
MADQSLLHSP INPHFFQPIL TESRTHLNIP VAFFSKHVEG RNNQNKTVTL RSDASDKTWL
VKMDGLKLTD GWEDFAFAHD LRTGDIVVFR LEGEMVFHVT ALGPSCCEIQ YHTSSHNIND
DDRNDQINIA SRNSSRVKKN PRKKVESSLD HSRFVAKVSA WCLSNDRLYI PLSFARLNGL
NKINSKKIYL QNEEGRSWKL VLRHDKSGMQ TFVQSGWRRF CSENGIRQGQ YTFKLVRKSA
PPVIRLCRAK AKPKQRSVAE YSSDHSCFEG SVTPSSLRND LLYLPRSFVN SNRLDKRCSE
IVLKNEQGVK WPLVLKRFKS VTYLPKGWTS FCQVNRIKAG DSFKFKLVGT WKKPVLSLCP
TQSNNHKTPL ECSEGNKSEE SEEDCLEVKK KKYWSRCRAS VENMDDDQTN IGNSSRKKRV
SKNPREKVES SSDHSSFVGS VNPSSLYKDQ LYLPRNFVSS NFLDKRCSEI VLKNERGEKR
TLVLKHFKKD LTFLKKGWTS FCQVNRIKAG DSFKFKLVGT WNKPVLSLCP TETNYHKTPL
ACSEGNKSEE SEEEGTEDKN TSQDCLEVKK RKYWSTCRAS AENIDDDQTN IGNSSKEKRV
KKNPVKKAES SSDHSSFVAN VTASSLNYDR LYLPLSFVSS NGLDKMNGKE IVLLNEEGLS
WKFNLKYNQA GKHTYVRPGW SRFCDANGMS QGQQFTFKLV QKHGPPVMYL SLSEHRPKSE
SSSHRSYFVG SVTASSIKKD KLYLWKSFVS SNGLDKGCKK IILKNKWGRE WKLVLKHYKS
NCFTIIKRGW TSFCQGNGLK AGDSFKFKLV GTGEKPVLSL CPAESSHEKI PLECPEGIDD
VNSLSSNPSS GDDSSRSEES EEENMEDKNI SQDCLETKKR KYCSSSSYSQ NRFVTLTLTR
SAFQTYKLVN GINKPRKITL LGQDGVKKVV DLYQESSSRI MRFGKGWREF FDAQGVKIDD
SFVLELIWEK EASPVLKFCT KVPK
Length = 984 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At1g26680

>At1g26680 hypothetical protein
          Length = 984

 Score = 91.5 bits (226), Expect = 6e-19
 Identities = 20/110 (18%), Positives = 36/110 (32%), Gaps = 5/110 (4%)

Query: 78  PARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFH 137
           P +K +       F   +  S ++   R+ LP     ++   L+   G  I +   +   
Sbjct: 604 PVKKAESSSDHSSFVANVTASSLNYD-RLYLPLSFVSSN--GLDKMNGKEIVLL-NEEGL 659

Query: 138 VWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVI 187
            W F  +Y        YV      F +A+G+  G              V+
Sbjct: 660 SWKFNLKY-NQAGKHTYVRPGWSRFCDANGMSQGQQFTFKLVQKHGPPVM 708



 Score = 83.8 bits (206), Expect = 1e-16
 Identities = 16/112 (14%), Positives = 32/112 (28%), Gaps = 6/112 (5%)

Query: 81  KIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWT 140
           K +    R  F   +  S +    ++ L K        +    +G    +        W 
Sbjct: 718 KSESSSHRSYFVGSVTASSIKKD-KLYLWKSFV----SSNGLDKGCKKIILKNKWGREWK 772

Query: 141 FKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKA 192
              +++ +N     +      F   +GL+ GD             V+    A
Sbjct: 773 LVLKHYKSNC-FTIIKRGWTSFCQGNGLKAGDSFKFKLVGTGEKPVLSLCPA 823



 Score = 82.6 bits (203), Expect = 3e-16
 Identities = 11/110 (10%), Positives = 30/110 (27%), Gaps = 8/110 (7%)

Query: 82  IDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTF 141
            +       F+  +  S + +   + LP+        +    +     +   +    W  
Sbjct: 259 AEYSSDHSCFEGSVTPSSLRNDL-LYLPRSFV----NSNRLDKRCSEIVLKNEQGVKWPL 313

Query: 142 KYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
             + +    S  Y+ +    F   + ++ GD             V+    
Sbjct: 314 VLKRF---KSVTYLPKGWTSFCQVNRIKAGDSFKFKLVGTWKKPVLSLCP 360



 Score = 79.2 bits (194), Expect = 2e-15
 Identities = 12/114 (10%), Positives = 34/114 (29%), Gaps = 7/114 (6%)

Query: 78  PARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFH 137
           P  K++       F   +  S +    ++ LP+    ++       +     +   +   
Sbjct: 424 PREKVESSSDHSSFVGSVNPSSLYKD-QLYLPRNFVSSNF----LDKRCSEIVLKNERGE 478

Query: 138 VWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
             T   +++       ++ +    F   + ++ GD          N  V+    
Sbjct: 479 KRTLVLKHF--KKDLTFLKKGWTSFCQVNRIKAGDSFKFKLVGTWNKPVLSLCP 530



 Score = 72.2 bits (176), Expect = 4e-13
 Identities = 19/116 (16%), Positives = 40/116 (34%), Gaps = 8/116 (6%)

Query: 78  PARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAA-EAHLPALECKEGIPIRMEDLDGF 136
           P +K++       F  ++    +S+  R+ +P   A    L  +  K+         +  
Sbjct: 141 PRKKVESSLDHSRFVAKVSAWCLSND-RLYIPLSFARLNGLNKINSKK----IYLQNEEG 195

Query: 137 HVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKA 192
             W    R    +  + +V      F + +G++ G          S   VI+  +A
Sbjct: 196 RSWKLVLR-HDKSGMQTFVQSGWRRFCSENGIRQGQ-YTFKLVRKSAPPVIRLCRA 249


InterPro Results:

IPR003340 Family
PF02362 T[14-107] 1.5e-30T[153-253] 1.6e-39T[267-365] 7.4e-42T[436-535] 7.1e-40T[616-717] 4.1e-41T[727-827] 3.1e-43T[893-984] 1.2e-11 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[57-172] 6.5e-13 Cupredoxins
Cupredoxin
NULL
seg ?[117-129]?[428-441]?[544-561]?[596-607]?[839-869]?[884-889] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 91 6e-19
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 91 3e-18
TF_17_2 ARFNPH4/ARF7 86 1e-16

TOP