AGI ID: At1g25560

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At1g25560
MEYSCVDDSS TTSESLSIST TPKPTTTTEK KLSSPPATSM RLYRMGSGGS SVVLDSENGV
ETESRKLPSS KYKGVVPQPN GRWGAQIYEK HQRVWLGTFN EEEEAASSYD IAVRRFRGRD
AVTNFKSQVD GNDAESAFLD AHSKAEIVDM LRKHTYADEF EQSRRKFVNG DGKRSGLETA
TYGNDAVLRA REVLFEKTVT PSDVGKLNRL VIPKQHAEKH FPLPAMTTAM GMNPSPTKGV
LINLEDRTGK VWRFRYSYWN SSQSYVLTKG WSRFVKEKNL RAGDVVCFER STGPDRQLYI
HWKVRSSPVQ TVVRLFGVNI FNVSNEKPND VAVECVGKKR SREDDLFSLG CSKKQAIINI
L
Length = 361 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At1g25560

>At1g25560 putative protein
          Length = 361

 Score =  181 bits (461), Expect = 7e-46
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 10/139 (7%)

Query: 158 MFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQ-------PRPSQELLARDLHGLEWR 210
           +F KT+T SD        +P++ AE  FP    +        P     +   D  G  WR
Sbjct: 194 LFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPAMTTAMGMNPSPTKGVLINLEDRTGKVWR 253

Query: 211 FRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR--GDDGKLRLGVR-RASQIEGTA 267
           FR+ Y    + ++LT GWS FV +K L +GD V F R  G D +L +  + R+S ++   
Sbjct: 254 FRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIHWKVRSSPVQTVV 313

Query: 268 ALSAQYNQNMNHNNFSEVA 286
            L      N+++   ++VA
Sbjct: 314 RLFGVNIFNVSNEKPNDVA 332


InterPro Results:

IPR001471 Domain
PD001423 T[81-118] 9e-16 sp_Q9C6M5_ARATH_Q9C6M5;
PR00367 T[72-83] 3.8e-05T[92-108] 3.8e-05 ETHRSPELEMNT
PF00847 T[70-131] 5.5e-31 AP2
SM00380 T[71-132] 6.1e-28 AP2
Pathogenesis-related transcriptional factor and ERF
IPR003340 Family
PF02362 T[194-308] 2e-25 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[234-314] 1.7e-07 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[9-36] seg
SSF54171 T[70-129] 3.2e-18 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3181 7e-46
TF_17_2 ARFNPH4/ARF7175 1e-43
TF_17_1 ARFMONOPTEROS/ARF5165 1e-40
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3129 5e-30
TF_22_1 ABI3/VP1FUSCA3116 1e-26
TF_67 Pti6104 6e-23
TF_2_2 AP2/EREBPAINTEGUMENTA105 8e-23
TF_68 ERF 95 2e-20
TF_66 Pti5 93 5e-20
TF_2_3 AP2/EREBPAPETALA2 94 1e-19
TF_2_4 AP2/EREBPCBF1 91 4e-19
TF_65 Pti4 87 7e-18
TF_2_5 AP2/EREBPDREB2A 78 7e-15
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 78 9e-15

TOP