AGI ID: At1g25550

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g25550
MMMFKSGDMD YTQKMKRCHE YVEALEEEQK KIQVFQRELP LCLELVTQAI ESCRKELSES
SEHVGGQSEC SERTTSECGG AVFEEFMPIK WSSASSDETD KDEEAEKTEM MTNENNDGDK
KKSDWLRSVQ LWNQSPDPQP NNKKPMVIEV KRSAGAFQPF QKEKPKAADS QPLIKAITPT
STTTTSSTAE TVGGGKEFEE QKQSHSNRKQ RRCWSPELHR RFLHALQQLG GSHVATPKQI
RDLMKVDGLT NDEVKSHLQK YRLHTRRPAT PVVRTGGENP QQRQFMVMEG IWVPSHDTTN
NRVYAPVATQ PPQSSTSGER SNRGCKSPAT SSTTTHTPHL LPLS
Length = 344 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g25550

>At1g25550 unknown protein
          Length = 344

 Score =  127 bits (320), Expect = 2e-29
 Identities = 37/70 (52%), Positives = 46/70 (64%)

Query: 177 QPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHL 236
           + Q+ +    K R  W+PELH RF++A+  LGG   ATPK I  LM VDGLT   +KSHL
Sbjct: 199 EEQKQSHSNRKQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHL 258

Query: 237 QKYRLNIRLP 246
           QKYRL+ R P
Sbjct: 259 QKYRLHTRRP 268


InterPro Results:

IPR001005 Domain
PF00249 T[211-262] 3e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[209-265] 1.6e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[205-269] 3.1e-19 Homeodomain-like
Homeodomain-like
NULL
coil ?[18-39] coiled-coil
seg ?[92-109]?[178-188]?[330-344] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like127 2e-29
TF_10_2 GARPARR-B class100 2e-22
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 80 3e-15
TF_1_2 MYB superfamilyLHY 73 6e-13

TOP