AGI ID: At1g22810

TF ID:TF_2_4
Super family:AP2/EREBP
Sub family:CBF1
Gene name: TINY-like transcription factor

Amino Acid Sequence:


1
61
121
>At1g22810
MDYRESTGES QSKYKGIRRR KWGKWVSEIR VPGTRDRLWL GSFSTAEGAA VAHDVAFFCL
HQPDSLESLN FPHLLNPSLV SRTSPRSIQQ AASNAGMAID AGIVHSTSVN SGCGDTTTYY
ENGADQVEPL NISVYDYLGG HDHV
Length = 144 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_4
Sbjct: At1g22810

>At1g22810 TINY-like transcription factor
          Length = 144

 Score =  129 bits (325), Expect = 9e-31
 Identities = 37/112 (33%), Positives = 49/112 (43%), Gaps = 3/112 (2%)

Query: 20  RVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYPTADMAARAHDVAVLALRGR 79
           R         Y+GIRRR   KWV E+R P  + R+WLG++ TA+ AA AHDVA   L   
Sbjct: 4   RESTGESQSKYKGIRRRKWGKWVSEIRVPGTRDRLWLGSFSTAEGAAVAHDVAFFCLHQP 63

Query: 80  SAC--LNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLESGITVLPCA 129
            +   LNF        V     P  I++ A+ A        + S      C 
Sbjct: 64  DSLESLNFPHLLNPSLVSR-TSPRSIQQAASNAGMAIDAGIVHSTSVNSGCG 114


InterPro Results:

IPR001471 Domain
PD001423 T[20-58] 3e-17 sp_O80542_ARATH_O80542;
PR00367 T[14-25] 6.2e-10T[36-52] 6.2e-10 ETHRSPELEMNT
PF00847 T[12-77] 1.1e-22 AP2
SM00380 T[13-78] 3.7e-33 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
SSF54171 T[12-75] 3e-18 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_4 AP2/EREBPCBF1129 9e-31
TF_2_2 AP2/EREBPAINTEGUMENTA110 2e-24
TF_68 ERF107 3e-24
TF_67 Pti6103 1e-22
TF_2_3 AP2/EREBPAPETALA2103 2e-22
TF_66 Pti5 84 3e-17
TF_65 Pti4 81 4e-16
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 80 2e-15
TF_2_5 AP2/EREBPDREB2A 77 1e-14

TOP