AGI ID: At1g20600

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At1g20600
MANSTGKPTS STQEDEEVTY ILAQLMQDVM DREEDIDDED DIDDEVASLP LLLVSQANQK
QSRKREEKTE KNQPKRVKNQ NIMKINIHDF SEETLRLIED WYNAELDPQD IFGDDEVTRR
FSRPIKKQLM SSDVDTDQSR LMLSKEQVKE KMLPFLEESE DPVKGVDVSV YGPDGEVQQM
KFKMWNGDKT PVLTSGWMQF VADYGLLKTS DFVTDGKVSQ LEHVFIRGSK VRCCNTS
Length = 237 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g20600

>At1g20600 hypothetical protein
          Length = 237

 Score =  111 bits (277), Expect = 3e-24
 Identities = 25/127 (19%), Positives = 43/127 (33%), Gaps = 7/127 (5%)

Query: 90  TDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTST-HGGFSVPRRA 148
           ++E    +      + D   +   D   +   +P     K L +SD  T      + +  
Sbjct: 91  SEETLRLIEDWYNAELDPQDIFGDDEVTRRFSRP---IKKQLMSSDVDTDQSRLMLSKEQ 147

Query: 149 A-EKIFPALDFSMQP-PCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKR-L 205
             EK+ P L+ S  P    ++            +       K  +LT+GW  FV+    L
Sbjct: 148 VKEKMLPFLEESEDPVKGVDVSVYGPDGEVQQMKFKMWNGDKTPVLTSGWMQFVADYGLL 207

Query: 206 FAGDSVL 212
              D V 
Sbjct: 208 KTSDFVT 214


InterPro Results:

NULL
seg ?[33-45] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7111 3e-24
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 73 8e-13
TF_22_1 ABI3/VP1FUSCA3 70 1e-12

TOP