AGI ID: At1g19850

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: transcription factor monopteros (MP)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
>At1g19850
MMASLSCVED KMKTSCLVNG GGTITTTTSQ STLLEEMKLL KDQSGTRKPV INSELWHACA
GPLVCLPQVG SLVYYFSQGH SEQVAVSTRR SATTQVPNYP NLPSQLMCQV HNVTLHADKD
SDEIYAQMSL QPVHSERDVF PVPDFGMLRG SKHPTEFFCK TLTASDTSTH GGFSVPRRAA
EKLFPPLDYS AQPPTQELVV RDLHENTWTF RHIYRGQPKR HLLTTGWSLF VGSKRLRAGD
SVLFIRDEKS QLMVGVRRAN RQQTALPSSV LSADSMHIGV LAAAAHATAN RTPFLIFYNP
RACPAEFVIP LAKYRKAICG SQLSVGMRFG MMFETEDSGK RRYMGTIVGI SDLDPLRWPG
SKWRNLQVEW DEPGCNDKPT RVSPWDIETP ESLFIFPSLT SGLKRQLHPS YFAGETEWGS
LIKRPLIRVP DSANGIMPYA SFPSMASEQL MKMMMRPHNN QNVPSFMSEM QQNIVMGNGG
LLGDMKMQQP LMMNQKSEMV QPQNKLTVNP SASNTSGQEQ NLSQSMSAPA KPENSTLSGC
SSGRVQHGLE QSMEQASQVT TSTVCNEEKV NQLLQKPGAS SPVQADQCLD ITHQIYQPQS
DPINGFSFLE TDELTSQVSS FQSLAGSYKQ PFILSSQDSS AVVLPDSTNS PLFHDVWDTQ
LNGLKFDQFS PLMQQDLYAS QNICMSNSTT SNILDPPLSN TVLDDFCAIK DTDFQNHPSG
CLVGNNNTSF AQDVQSQITS ASFADSQAFS RQDFPDNSGG TGTSSSNVDF DDCSLRQNSK
GSSWQKIATP RVRTYTKVQK TGSVGRSIDV TSFKDYEELK SAIECMFGLE GLLTHPQSSG
WKLVYVDYES DVLLVGDDPW EEFVGCVRCI RILSPTEVQQ MSEEGMKLLN SAGINDLKTS
VS
Length = 902 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g19850

>At1g19850 transcription factor monopteros (MP)
          Length = 902

 Score = 1209 bits (3128), Expect = 0.0
 Identities = 876/902 (97%), Positives = 876/902 (97%)

Query: 1   MMASLSCVEDKMKTSCLVNXXXXXXXXXSQSTLLEEMKLLKDQSGTRKPVINSELWHACA 60
           MMASLSCVEDKMKTSCLVN         SQSTLLEEMKLLKDQSGTRKPVINSELWHACA
Sbjct: 1   MMASLSCVEDKMKTSCLVNGGGTITTTTSQSTLLEEMKLLKDQSGTRKPVINSELWHACA 60

Query: 61  GPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKD 120
           GPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKD
Sbjct: 61  GPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKD 120

Query: 121 SDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAA 180
           SDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAA
Sbjct: 121 SDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAA 180

Query: 181 EKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGD 240
           EKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGD
Sbjct: 181 EKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGD 240

Query: 241 SVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXXXXXXXXNRTPFLIFYNP 300
           SVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVL        NRTPFLIFYNP
Sbjct: 241 SVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAAAHATANRTPFLIFYNP 300

Query: 301 RACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPG 360
           RACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPG
Sbjct: 301 RACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPG 360

Query: 361 SKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGS 420
           SKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGS
Sbjct: 361 SKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGS 420

Query: 421 LIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGG 480
           LIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGG
Sbjct: 421 LIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGG 480

Query: 481 LLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGC 540
           LLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGC
Sbjct: 481 LLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGC 540

Query: 541 SSGRVQHGLEQSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCLDITHQIYQPQS 600
           SSGRVQHGLEQSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCLDITHQIYQPQS
Sbjct: 541 SSGRVQHGLEQSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCLDITHQIYQPQS 600

Query: 601 DPINGFSFLETDELTSQVSSFQSLAGSYKQPFILSSQDSSAVVLPDSTNSPLFHDVWDTQ 660
           DPINGFSFLETDELTSQVSSFQSLAGSYKQPFILSSQDSSAVVLPDSTNSPLFHDVWDTQ
Sbjct: 601 DPINGFSFLETDELTSQVSSFQSLAGSYKQPFILSSQDSSAVVLPDSTNSPLFHDVWDTQ 660

Query: 661 LNGLKFDQFSPLMQQDLYASQNICMSNSTTSNILDPPLSNTVLDDFCAIKDTDFQNHPSG 720
           LNGLKFDQFSPLMQQDLYASQNICMSNSTTSNILDPPLSNTVLDDFCAIKDTDFQNHPSG
Sbjct: 661 LNGLKFDQFSPLMQQDLYASQNICMSNSTTSNILDPPLSNTVLDDFCAIKDTDFQNHPSG 720

Query: 721 CLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNXXXXXXXXXNVDFDDCSLRQNSK 780
           CLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDN         NVDFDDCSLRQNSK
Sbjct: 721 CLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNSGGTGTSSSNVDFDDCSLRQNSK 780

Query: 781 GSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSG 840
           GSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSG
Sbjct: 781 GSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSG 840

Query: 841 WKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTS 900
           WKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTS
Sbjct: 841 WKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTS 900

Query: 901 VS 902
           VS
Sbjct: 901 VS 902


InterPro Results:

IPR003311 Family
PF02309 T[722-885] 0.00089 AUX_IAA
AUX/IAA protein
IPR003340 Family
PF02362 T[157-262] 2.4e-25 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[284-367] 6.3e-58 Auxin_resp
Auxin response factor
NULL
seg ?[20-28]?[282-289]?[758-766] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5209 0.0
TF_17_2 ARFNPH4/ARF7573 e-163
TF_17_3 ARFETTIN/ARF3492 e-139
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3147 2e-35
TF_55 Aux/IAA133 9e-32
TF_22_1 ABI3/VP1FUSCA3119 2e-27

TOP