AGI ID: At1g19220

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: auxin response factor (ARF) like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
>At1g19220
MKAPSNGFLP SSNEGEKKPI NSQLWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ
TDFIPNYPNL PSKLICLLHS VTLHADTETD EVYAQMTLQP VNKYDREALL ASDMGLKLNR
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFVRDEKSQL MLGIRRANRQ TPTLSSSVIS
SDSMHIGILA AAAHANANSS PFTIFFNPRA SPSEFVVPLA KYNKALYAQV SLGMRFRMMF
ETEDCGVRRY MGTVTGISDL DPVRWKGSQW RNLQVGWDES TAGDRPSRVS IWEIEPVITP
FYICPPPFFR PKYPRQPGMP DDELDMENAF KRAMPWMGED FGMKDAQSSM FPGLSLVQWM
SMQQNNPLSG SATPQLPSAL SSFNLPNNFA SNDPSKLLNF QSPNLSSANS QFNKPNTVNH
ISQQMQAQPA MVKSQQQQQQ QQQQHQHQQQ QLQQQQQLQM SQQQVQQQGI YNNGTIAVAN
QVSCQSPNQP TGFSQSQLQQ QSMLPTGAKM THQNINSMGN KGLSQMTSFA QEMQFQQQLE
MHNSSQLLRN QQEQSSLHSL QQNLSQNPQQ LQMQQQSSKP SPSQQLQLQL LQKLQQQQQQ
QSIPPVSSSL QPQLSALQQT QSHQLQQLLS SQNQQPLAHG NNSFPASTFM QPPQIQVSPQ
QQGQMSNKNL VAAGRSHSGH TDGEAPSCST SPSANNTGHD NVSPTNFLSR NQQQGQAASV
SASDSVFERA SNPVQELYTK TESRISQGMM NMKSAGEHFR FKSAVTDQID VSTAGTTYCP
DVVGPVQQQQ TFPLPSFGFD GDCQSHHPRN NLAFPGNLEA VTSDPLYSQK DFQNLVPNYG
NTPRDIETEL SSAAISSQSF GIPSIPFKPG CSNEVGGIND SGIMNGGGLW PNQTQRMRTY
TKVQKRGSVG RSIDVTRYSG YDELRHDLAR MFGIEGQLED PLTSDWKLVY TDHENDILLV
GDDPWEEFVN CVQNIKILSS VEVQQMSLDG DLAAIPTTNQ ACSETDSGNA WKVHYEDTSA
AASFNR
Length = 1086 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g19220

>At1g19220 auxin response factor (ARF) like protein
          Length = 1086

 Score =  654 bits (1688), Expect = 0.0
 Identities = 372/486 (76%), Positives = 413/486 (84%), Gaps = 9/486 (1%)

Query: 1   MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQK 60
           MKAPS NG  P+  EGE++ INS+LWHACAGPL+SLPP GSLVVYFPQGHSEQVAASMQK
Sbjct: 1   MKAPS-NGFLPSSNEGEKKPINSQLWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQK 59

Query: 61  QTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLN 120
           QTDFIP+YPNLPSKLIC+LH+VTL+AD ETDEVYAQMTLQPVNKYDR+ALLASDMGLKLN
Sbjct: 60  QTDFIPNYPNLPSKLICLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLN 119

Query: 121 RQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFR 180
           RQP EFFCKTLTASDTSTHGGFSVPRRAAEKIFP LDFSMQPP QE+VAKD+HD TWTFR
Sbjct: 120 RQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFR 179

Query: 181 HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALXXXXX 240
           HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLF+RD K+QL+LGIRRANRQ P L     
Sbjct: 180 HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVI 239

Query: 241 XXXXMHIGVLXXXXXXXXXXSPFTIFYNPRWAAPAEFVVPLAKYTKAMYAQVSLGMRFRM 300
               MHIG+L          SPFTIF+NPR A+P+EFVVPLAKY KA+YAQVSLGMRFRM
Sbjct: 240 SSDSMHIGILAAAAHANANSSPFTIFFNPR-ASPSEFVVPLAKYNKALYAQVSLGMRFRM 298

Query: 301 IFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVL 360
           +FETE+CGVRRYMGTVTGISDLDPVRWK SQWRNLQ+GWDES AGDRPSRVS+W+IEPV+
Sbjct: 299 MFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVI 358

Query: 361 TPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQ 420
           TPFYICPPPFFRP++  QPGMPDDE DME+A KRAMPW+     MKD  S++FPGLSLVQ
Sbjct: 359 TPFYICPPPFFRPKYPRQPGMPDDELDMENAFKRAMPWMGEDFGMKDAQSSMFPGLSLVQ 418

Query: 421 WMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQ 480
           WM+MQQ N    SA  Q    PS LS +  L NN   ++DPSKLL+FQ+P+  +SS+N Q
Sbjct: 419 WMSMQQNNPLSGSATPQ---LPSALS-SFNLPNNF-ASNDPSKLLNFQSPN--LSSANSQ 471

Query: 481 FNKQNQ 486
           FNK N 
Sbjct: 472 FNKPNT 477



 Score =  399 bits (1026), Expect = e-111
 Identities = 203/401 (50%), Positives = 265/401 (65%), Gaps = 35/401 (8%)

Query: 793  HQFPSSCTNN---GLSTLQPPQMLVSRPQEKQ--NPPVGGGVKAYSGITDGG--DAXXXX 845
            +Q P +  NN     + +QPPQ+ VS  Q+ Q  N  +    +++SG TDG         
Sbjct: 693  NQQPLAHGNNSFPASTFMQPPQIQVSPQQQGQMSNKNLVAAGRSHSGHTDGEAPSCSTSP 752

Query: 846  XXXXXXXCQISSSGFLNRSQ---SGPAILIPDAAIDMSGNLVQDLYSKSDMRLKQELVGQ 902
                     +S + FL+R+Q      ++   D+  + + N VQ+LY+K++ R+ Q ++  
Sbjct: 753  SANNTGHDNVSPTNFLSRNQQQGQAASVSASDSVFERASNPVQELYTKTESRISQGMMNM 812

Query: 903  QKS------KASLTDHQLEASASGTSYGLD-GGENNRQQNFLAPTFGLDGD-----SRNS 950
            + +      K+++TD Q++ S +GT+Y  D  G   +QQ F  P+FG DGD      RN+
Sbjct: 813  KSAGEHFRFKSAVTD-QIDVSTAGTTYCPDVVGPVQQQQTFPLPSFGFDGDCQSHHPRNN 871

Query: 951  LLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMSTSAVRTQSFGVPNV 1010
            L    N+      + + S    SQKD QN++ NYG    DI TE+S++A+ +QSFG+P++
Sbjct: 872  LAFPGNL------EAVTSDPLYSQKDFQNLVPNYGNTPRDIETELSSAAISSQSFGIPSI 925

Query: 1011 PA---ISNDL-AVNDAGVL-GGGLWPAQTQRMRTYTKVQKRGSVGRSIDVNRYRGYDELR 1065
            P     SN++  +ND+G++ GGGLWP QTQRMRTYTKVQKRGSVGRSIDV RY GYDELR
Sbjct: 926  PFKPGCSNEVGGINDSGIMNGGGLWPNQTQRMRTYTKVQKRGSVGRSIDVTRYSGYDELR 985

Query: 1066 HDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIKILSSAEVQQ 1125
            HDLARMFGIEGQLEDP TSDWKLVY DHENDILLVGDDPWEEFVNCVQ+IKILSS EVQQ
Sbjct: 986  HDLARMFGIEGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILSSVEVQQ 1045

Query: 1126 MSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNS-ATSFNR 1165
            MSLDG+ A +P TNQACS  DSGNAW+ HY+D S A SFNR
Sbjct: 1046 MSLDGDLAAIPTTNQACSETDSGNAWKVHYEDTSAAASFNR 1086


InterPro Results:

IPR003340 Family
PF02362 T[125-230] 1.1e-19 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[252-334] 4.9e-56 Auxin_resp
Auxin response factor
NULL
coil ?[495-519] coiled-coil
seg ?[30-43]?[235-243]?[250-258]?[486-528]?[554-562]?[611-697]?[711-724]?[772-785] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7654 0.0
TF_17_1 ARFMONOPTEROS/ARF5561 e-160
TF_17_3 ARFETTIN/ARF3508 e-144
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3135 7e-32
TF_55 Aux/IAA121 5e-28
TF_22_1 ABI3/VP1FUSCA3116 1e-26

TOP