AGI ID: At1g19210

TF ID:TF_2_2
Super family:AP2/EREBP
Sub family:AINTEGUMENTA
Gene name: AP2 domain-containing unknown protein

Amino Acid Sequence:


1
61
121
181
>At1g19210
MEGSSSSMQS KYKGVRKRKW GKWVSEIRLP NSRERIWLGS YDTPEKAARA FDAALYCLRG
NNAKFNFPDN PPVISGGRNL SRSEIREAAA RFANSAEDDS SGGAGYEIRQ ESASTSMDVD
SEFLSMLPTV GSGNFASEFG LFPGFDDFSD EYSGDRFREQ LSPTQDYYQL GEETYADGSM
FLWNF
Length = 185 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_2
Sbjct: At1g19210

>At1g19210 AP2 domain-containing unknown protein
          Length = 185

 Score =  144 bits (362), Expect = 2e-34
 Identities = 34/164 (20%), Positives = 55/164 (32%), Gaps = 12/164 (7%)

Query: 377 SGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFGTQEEAAEAYDVAAIKFRGT 436
              S   S Y+GV R  + G+W + I      + ++LG++ T E+AA A+D A    RG 
Sbjct: 3   GSSSSMQSKYKGV-RKRKWGKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGN 61

Query: 437 NAVTNFDITRYDVDRIMSSNTLLSGELARRNNNSIVVRNT---EDQTALNAVVEGGSNKE 493
           NA  NF      +    + +     E A R  NS    ++     +    +         
Sbjct: 62  NAKFNFPDNPPVISGGRNLSRSEIREAAARFANSAEDDSSGGAGYEIRQESASTSMDVDS 121

Query: 494 VSTPERLLSFPAIFA--------LPQVNQKMFGSNMGGNMSPWT 529
                        FA            + +  G      +SP  
Sbjct: 122 EFLSMLPTVGSGNFASEFGLFPGFDDFSDEYSGDRFREQLSPTQ 165



 Score = 95.9 bits (237), Expect = 5e-20
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 276 TFGQRTSQYRGVTRHRWTGRYEAHLWDNSFKKEGHSRKGRQVYLGGYDMEEKAARAYDLA 335
           +     S+Y+GV + +W G++ + +   + ++        +++LG YD  EKAARA+D A
Sbjct: 4   SSSSMQSKYKGVRKRKW-GKWVSEIRLPNSRE--------RIWLGSYDTPEKAARAFDAA 54

Query: 336 ALKYWGPSTHTNFSAEN 352
                G +   NF    
Sbjct: 55  LYCLRGNNAKFNFPDNP 71


InterPro Results:

IPR001471 Domain
PD001423 T[18-60] 7e-20 sp_Q9LMA5_ARATH_Q9LMA5;
PR00367 T[12-23] 9.4e-11T[34-50] 9.4e-11 ETHRSPELEMNT
PF00847 T[10-73] 8.8e-32 AP2
SM00380 T[11-74] 1.2e-30 AP2
Pathogenesis-related transcriptional factor and ERF
IPR006032 Family
PS00055 ?[28-35] NA RIBOSOMAL_S12
Ribosomal protein S12/S23
NULL
SSF54171 T[10-70] 1.2e-22 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_2 AP2/EREBPAINTEGUMENTA144 2e-34
TF_2_4 AP2/EREBPCBF1134 4e-32
TF_68 ERF121 3e-28
TF_67 Pti6114 5e-26
TF_65 Pti4109 2e-24
TF_2_3 AP2/EREBPAPETALA2109 3e-24
TF_2_5 AP2/EREBPDREB2A 94 1e-19
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 91 9e-19
TF_66 Pti5 89 9e-19

TOP