AGI ID: At1g16060

TF ID:TF_2_2
Super family:AP2/EREBP
Sub family:AINTEGUMENTA
Gene name: putative transcription factor CKC protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g16060
MFIAVEVSPV MEDITRQSKK TSVENETGDD QSATSVVLKA KRKRRSQPRD APPQRSSVHR
GVTRHRWTGR YEAHLWDKNS WNETQTKKGR QVYLGAYDEE DAAARAYDLA ALKYWGRDTI
LNFPLCNYEE DIKEMESQSK EEYIGSLRRK SSGFSRGVSK YRGVAKHHHN GRWEARIGRV
FGNKYLYLGT YATQEEAAIA YDIAAIEYRG LNAVTNFDIS RYLKLPVPEN PIDTANNLLE
SPHSDLSPFI KPNHESDLSQ SQSSSEDNDD RKTKLLKSSP LVAEEVIGPS TPPEIAPPRR
SFPEDIQTYF GCQNSGKLTA EEDDVIFGDL DSFLTPDFYS ELNDC
Length = 345 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_2
Sbjct: At1g16060

>At1g16060 putative transcription factor CKC protein
          Length = 345

 Score =  224 bits (571), Expect = 1e-58
 Identities = 135/316 (42%), Positives = 180/316 (56%), Gaps = 41/316 (12%)

Query: 236 LVETSVGFETTTMAAAKKKRGQEDVVVVGQKQIVHRKSIDTFGQRTSQYRGVTRHRWTGR 295
             +TSV  ET    +A         VV+  K+    +  D   QR+S +RGVTRHRWTGR
Sbjct: 18  SKKTSVENETGDDQSA-------TSVVLKAKRKRRSQPRDAPPQRSSVHRGVTRHRWTGR 70

Query: 296 YEAHLWDNSFKKEGHSRKGRQVYLGGYDMEEKAARAYDLAALKYWGPSTHTNFSAENYQK 355
           YEAHLWD +   E  ++KGRQVYLG YD E+ AARAYDLAALKYWG  T  NF   NY++
Sbjct: 71  YEAHLWDKNSWNETQTKKGRQVYLGAYDEEDAAARAYDLAALKYWGRDTILNFPLCNYEE 130

Query: 356 EIEDMKNMTRQEYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGT 415
           +I++M++ +++EY+  LRRKSSGFSRG S YRGV +HH +GRW+ARIGRV GNK LYLGT
Sbjct: 131 DIKEMESQSKEEYIGSLRRKSSGFSRGVSKYRGVAKHHHNGRWEARIGRVFGNKYLYLGT 190

Query: 416 FGTQEEAAEAYDVAAIKFRGTNAVTNFDITRYD-VDRIMS-SNTLLSGELARRNNNSIVV 473
           + TQEEAA AYD+AAI++RG NAVTNFDI+RY  +    +  +T  +   +  ++ S  +
Sbjct: 191 YATQEEAAIAYDIAAIEYRGLNAVTNFDISRYLKLPVPENPIDTANNLLESPHSDLSPFI 250

Query: 474 RNTE------------------------DQTALNAVVEGGSNKEVSTPERLLSFPAIFAL 509
           +                                  V+   +  E+         P   + 
Sbjct: 251 KPNHESDLSQSQSSSEDNDDRKTKLLKSSPLVAEEVIGPSTPPEI--------APPRRSF 302

Query: 510 PQVNQKMFGSNMGGNM 525
           P+  Q  FG    G +
Sbjct: 303 PEDIQTYFGCQNSGKL 318


InterPro Results:

IPR001471 Domain
PD001423 T[171-211] 0.0001 sp_Q9FIE2_ARATH_Q9FIE2;
PR00367 T[59-70] 3.1e-06T[200-220] 3.1e-06 ETHRSPELEMNT
PF00847 T[57-129] 4.3e-35T[159-223] 2e-28 AP2
SM00380 T[58-130] 4.2e-24T[160-224] 1.4e-25 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[96-112]?[195-208]?[255-270] seg
SSF54171 T[57-126] 2e-18T[159-220] 9.6e-20 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_2 AP2/EREBPAINTEGUMENTA224 1e-58
TF_2_3 AP2/EREBPAPETALA2209 3e-54
TF_67 Pti6 92 2e-19
TF_2_4 AP2/EREBPCBF1 88 3e-18
TF_68 ERF 75 3e-14
TF_66 Pti5 73 7e-14
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 70 1e-12
TF_2_5 AP2/EREBPDREB2A 42 4e-04

TOP