AGI ID: At1g15050

TF ID:TF_55
Super family:Aux/IAA
Sub family:
Gene name: IAA34

Amino Acid Sequence:


1
61
121
181
>At1g15050
MYCSDPPHPL HLVASDKQQK DHKLILSWKK PTMDSDPLGV FPNSPKYHPY YSQTTEFGGV
IDLGLSLRTI QHEIYHSSGQ RYCSNEGYRR KWGYVKVTMD GLVVGRKVCV LDHGSYSTLA
HQLEDMFGMQ SVSGLRLFQM ESEFCLVYRD EEGLWRNAGD VPWNEFIESV ERLRITRRND
AVLPF
Length = 185 AA.

PSI BLAST Result:

Query: Query sequence of TF_55
Sbjct: At1g15050

>At1g15050 IAA34
          Length = 185

 Score =  129 bits (326), Expect = 9e-31
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 15/115 (13%)

Query: 101 QKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMI 160
             + G      +VKV+MDG    RK+ +  + SY  L++ L +MF   ++          
Sbjct: 83  CSNEGYRRKWGYVKVTMDGLVVGRKVCVLDHGSYSTLAHQLEDMFGMQSV---------- 132

Query: 161 DFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAI 215
                  L       ++   Y D++G W   GDVPW  F+++ +RLR+ + +DA+
Sbjct: 133 -----SGLRLFQMESEFCLVYRDEEGLWRNAGDVPWNEFIESVERLRITRRNDAV 182


InterPro Results:

IPR003311 Family
PF02309 T[10-184] 1.1e-05 AUX_IAA
AUX/IAA protein
IPR006025 Binding_site
PS00142 ?[69-78] NA ZINC_PROTEASE
Peptidase M, neutral zinc metallopeptidases, zinc-binding site

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_55 Aux/IAA129 9e-31
TF_17_1 ARFMONOPTEROS/ARF5125 1e-28
TF_17_2 ARFNPH4/ARF7124 3e-28

TOP