AGI ID: At1g14600

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
>At1g14600
MGRCGRSNDG VIGGVRPYVR SPVPRLRWTP ELHRSFVHAV DLLGGQYKAT PKLVLKIMDV
KGLTISHVKS HLQVKENAKK ILF
Length = 83 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g14600

>At1g14600 hypothetical protein
          Length = 83

 Score = 97.4 bits (241), Expect = 2e-20
 Identities = 36/58 (62%), Positives = 41/58 (70%)

Query: 180 RAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQ 237
           R        RLRWTPELH  FV+AV+ LGG  KATPK +LK+M V GLTI H+KSHLQ
Sbjct: 16  RPYVRSPVPRLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQ 73


InterPro Results:

IPR001005 Domain
PF00249 T[25-76] 3.5e-07 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[24-79] 6.8e-21 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[19-80] 4.5e-15 Homeodomain-like
Homeodomain-like

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like 97 2e-20
TF_10_2 GARPARR-B class 78 8e-16
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 67 3e-11
TF_1_2 MYB superfamilyLHY 65 2e-10

TOP