AGI ID: At1g13300

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g13300
MIKKFSNMDY NQKRERCGQY IEALEEERRK IHVFQRELPL CLDLVTQAIE ACKRELPEMT
TENMYGQPEC SEQTTGECGP VLEQFLTIKD SSTSNEEEDE EFDDEHGNHD PDNDSEDKNT
KSDWLKSVQL WNQPDHPLLP KEERLQQETM TRDESMRKDP MVNGGEGRKR EAEKDGGGGR
KQRRCWSSQL HRRFLNALQH LGGPHVATPK QIREFMKVDG LTNDEVKSHL QKYRLHTRRP
RQTVPNNGNS QTQHFVVVGG LWVPQSDYST GKTTGGATTS STTTTTGIYG TMAAPPPPQW
PSHSNYRPSI IVDEGSGSHS EGVVVRCSSP AMSSSTRNHY VKNN
Length = 344 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g13300

>At1g13300 unknown protein
          Length = 344

 Score =  119 bits (298), Expect = 7e-27
 Identities = 36/70 (51%), Positives = 46/70 (65%)

Query: 177 QPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHL 236
           + ++   G  K R  W+ +LH RF+NA+  LGGP  ATPK I + M VDGLT   +KSHL
Sbjct: 171 EAEKDGGGGRKQRRCWSSQLHRRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHL 230

Query: 237 QKYRLNIRLP 246
           QKYRL+ R P
Sbjct: 231 QKYRLHTRRP 240


InterPro Results:

IPR001005 Domain
PF00249 T[183-234] 2.9e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[181-237] 1.2e-38 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[177-241] 8.7e-17 Homeodomain-like
Homeodomain-like
NULL
coil ?[10-31] coiled-coil
seg ?[96-105]?[269-291] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like119 7e-27
TF_10_2 GARPARR-B class 96 4e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 75 1e-13
TF_1_2 MYB superfamilyLHY 71 3e-12

TOP