AGI ID: At1g13260

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g13260
MESSSVDEST TSTGSICETP AITPAKKSSV GNLYRMGSGS SVVLDSENGV EAESRKLPSS
KYKGVVPQPN GRWGAQIYEK HQRVWLGTFN EEDEAARAYD VAVHRFRRRD AVTNFKDVKM
DEDEVDFLNS HSKSEIVDML RKHTYNEELE QSKRRRNGNG NMTRTLLTSG LSNDGVSTTG
FRSAEALFEK AVTPSDVGKL NRLVIPKHHA EKHFPLPSSN VSVKGVLLNF EDVNGKVWRF
RYSYWNSSQS YVLTKGWSRF VKEKNLRAGD VVSFSRSNGQ DQQLYIGWKS RSGSDLDAGR
VLRLFGVNIS PESSRNDVVG NKRVNDTEML SLVCSKKQRI FHAS
Length = 344 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g13260

>At1g13260 putative protein
          Length = 344

 Score =  197 bits (501), Expect = 4e-50
 Identities = 46/175 (26%), Positives = 69/175 (39%), Gaps = 2/175 (1%)

Query: 59  QKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLK 118
           + + DF+ S+    S+++ ML   T N + E  +                 L    +   
Sbjct: 122 EDEVDFLNSHSK--SEIVDMLRKHTYNEELEQSKRRRNGNGNMTRTLLTSGLSNDGVSTT 179

Query: 119 LNRQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWT 178
             R     F K +T SD        +P+  AEK FP    ++      L  +D++   W 
Sbjct: 180 GFRSAEALFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWR 239

Query: 179 FRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQP 233
           FR+ Y    + ++LT GWS FV  K L AGD V F R       L I   +R   
Sbjct: 240 FRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGS 294


InterPro Results:

IPR001471 Domain
PD001423 T[71-107] 3e-15 sp_Q9LS06_ARATH_Q9LS06;
PR00367 T[62-73] 9.2e-06T[82-98] 9.2e-06 ETHRSPELEMNT
PF00847 T[60-121] 8.8e-29 AP2
SM00380 T[61-122] 5.2e-26 AP2
Pathogenesis-related transcriptional factor and ERF
IPR003340 Family
PF02362 T[187-294] 1.3e-27 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[220-300] 2.5e-06 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[3-15]?[154-161] seg
SSF54171 T[60-118] 1.7e-18 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7197 4e-50
TF_17_3 ARFETTIN/ARF3193 3e-49
TF_17_1 ARFMONOPTEROS/ARF5169 6e-42
TF_22_1 ABI3/VP1FUSCA3123 1e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3121 1e-27
TF_2_2 AP2/EREBPAINTEGUMENTA116 4e-26
TF_67 Pti6111 4e-25
TF_2_3 AP2/EREBPAPETALA2100 3e-21
TF_2_4 AP2/EREBPCBF1 94 4e-20
TF_68 ERF 94 5e-20
TF_65 Pti4 83 2e-16
TF_66 Pti5 79 1e-15
TF_2_5 AP2/EREBPDREB2A 76 2e-14
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 74 1e-13

TOP