AGI ID: At1g10455

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative protein

Amino Acid Sequence:


1
61
121
>At1g10455
MAQNKNLNLE LSLSQYVEDD PWVLKKKLSD SDLYYSAQLY LPKQEMEHFV LPEMDHDLVR
KLGAGVEVKV RDVDSVDDFY TVRLKVRNGQ YYLGKGWGLI KNAKVLNTGD HIGLFWDKLT
REVKFKHFKS QSITMHREAG TTSTQKNVLQ KK
Length = 152 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g10455

>At1g10455 putative protein
          Length = 152

 Score = 90.0 bits (222), Expect = 6e-18
 Identities = 21/103 (20%), Positives = 37/103 (35%), Gaps = 8/103 (7%)

Query: 121 RQPNEFFCKTLTASDTSTHGGFSVPRRAAEKI-FPALDFSMQPP---CQELVAKDIHD-- 174
                   K L+ SD        +P++  E    P +D  +        E+  +D+    
Sbjct: 18  EDDPWVLKKKLSDSDLYYSAQLYLPKQEMEHFVLPEMDHDLVRKLGAGVEVKVRDVDSVD 77

Query: 175 NTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDG 217
           + +T R   R    ++ L  GW +  + K L  GD +    D 
Sbjct: 78  DFYTVRLKVRN--GQYYLGKGWGLIKNAKVLNTGDHIGLFWDK 118


Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 90 6e-18
TF_22_1 ABI3/VP1FUSCA3 82 4e-16
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 81 2e-15

TOP