AGI ID: At1g05930

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein, 3' partial

Amino Acid Sequence:


1
61
121
181
241
301
>At1g05930
MTTNDDDHAA ERNTMSMNYE LAATLSDEEQ RARKGKAKIV CKEEDHVFIK KKEKYEEESE
KREFFSHVPR KIRPALRYPQ PNFENPNGAS SSLNLPFEED YYMAEYYKKT ETINPPNPYH
QWSPSSFLTE YTHPRMLEVM KDMRAEDLTL ILEKTLSTTD VITTTHGRFS MHFNRLISND
FLKPEERSIL EEDTYNDETM GVGAILVDQR SQKWSVILKR WGQNYFLSCG WNDVVKANKL
KAGDDICLWA FSIAPIFVID KFLVSVEIHI GLIFQAILET PSLCLTGDHE PQEACGVTER
DRVALPMLAV SAKLLVSVEI DLHLYSRLSW GNSRGFWSYY NAR
Length = 343 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g05930

>At1g05930 hypothetical protein, 3' partial
          Length = 343

 Score =  104 bits (260), Expect = 3e-22
 Identities = 22/112 (19%), Positives = 37/112 (32%), Gaps = 14/112 (12%)

Query: 115 MGLKLNRQPNEFFCKTLTASDT--STHGGFSVPRRAAE----------KIFPALDFSMQP 162
           M             KTL+ +D   +THG FS+                 I     ++ + 
Sbjct: 140 MKDMRAEDLTLILEKTLSTTDVITTTHGRFSMHFNRLISNDFLKPEERSILEEDTYNDET 199

Query: 163 PCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI 214
                +  D     W+      G  + + L+ GW+  V   +L AGD +   
Sbjct: 200 MGVGAILVDQRSQKWSVILKRWG--QNYFLSCGWNDVVKANKLKAGDDICLW 249


InterPro Results:

IPR005508 Domain
PF03754 T[132-237] 3.4e-54 DUF313
Protein of unknown function DUF313
NULL
seg ?[50-63] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7104 3e-22
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 94 3e-19
TF_22_1 ABI3/VP1FUSCA3 86 3e-17

TOP