AGI ID: At1g05920

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g05920
MSSRDKPKTF AEVREEICKR REEMISRDNQ KKTKTVAQVR EEKGKRREEM ISRYNQKKAK
TVAQVKEGKG KRREEMISRD NRTKPKTVAQ VRDAKRKRTF DHVPRGTREP HAYLRNDPAP
QVASVPKSVP EEKDVILDRI LSNVPRRKKT TSYEFVPPKH PQEPQWLLQV MSRMNGAGDP
KLIIEKNLDS NDVDPRQNRL SIPINTVIQN DFLTLDESRL IDEDEITNEG NMGVAAFLVD
QRTKKWNMGF KQWFMTTDSG SSYWSFVLRG EWSNVVETNG LKEGDKISLW SFRSNDILCF
ALVPPTSSVV ESLDK
Length = 315 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g05920

>At1g05920 hypothetical protein
          Length = 315

 Score =  162 bits (411), Expect = 1e-39
 Identities = 27/202 (13%), Positives = 46/202 (22%), Gaps = 28/202 (13%)

Query: 47  PQGHSEQVAASMQKQTDFIPSYPNLPSK----LICMLHNVTLNADPETDEVYAQMTLQPV 102
           P+G  E  A         + S P    +    ++  + +        T   +    + P 
Sbjct: 104 PRGTREPHAYLRNDPAPQVASVPKSVPEEKDVILDRILSNVPRRKKTTSYEF----VPPK 159

Query: 103 NKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTS-THGGFSVPRRAAE--KIFPALDF- 158
           +  +   LL     +     P     K L ++D        S+P             +  
Sbjct: 160 HPQEPQWLLQVMSRMNGAGDPKLIIEKNLDSNDVDPRQNRLSIPINTVIQNDFLTLDESR 219

Query: 159 --------SMQPPCQELVAKDIHDNTWTFRHIYRGQP-------KRHLLTTGWSVFVSTK 203
                   +           D     W                    +L   WS  V T 
Sbjct: 220 LIDEDEITNEGNMGVAAFLVDQRTKKWNMGFKQWFMTTDSGSSYWSFVLRGEWSNVVETN 279

Query: 204 RLFAGDSVLFIRDGKAQ-LLLG 224
            L  GD +          L   
Sbjct: 280 GLKEGDKISLWSFRSNDILCFA 301


InterPro Results:

IPR005508 Domain
PF03754 T[161-278] 2e-72 DUF313
Protein of unknown function DUF313

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7162 1e-39
TF_22_1 ABI3/VP1FUSCA3 98 6e-21
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 99 1e-20

TOP