AGI ID: At1g05615

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
>At1g05615
MGAIHDEPFT ACGDETECFG GNREGSQSFH SSSTKEENLE DSYLYLVHQR SMSIFFWDER
ANTGVAGAVD EGKIIDFEFL NPDEKRIIEE HANKEREEGV DVILVNFDRR EYMLNLRRWN
MGTSPLYILV SGRYNVVKGC RLKEGNEIRI WSFHFDDQLN LAMVPLTPTE SG
Length = 172 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At1g05615

>At1g05615 putative protein
          Length = 172

 Score = 61.0 bits (147), Expect = 9e-10
 Identities = 16/81 (19%), Positives = 33/81 (39%), Gaps = 3/81 (3%)

Query: 110 KKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVL-ENTGDFVNAHGL 168
           K+  E H    E +EG+ + + + D    +    R W    S +Y+L     + V    L
Sbjct: 85  KRIIEEHANK-EREEGVDVILVNFDR-REYMLNLRRWNMGTSPLYILVSGRYNVVKGCRL 142

Query: 169 QLGDFIMVYQDLYSNNYVIQA 189
           + G+ I ++   + +   +  
Sbjct: 143 KEGNEIRIWSFHFDDQLNLAM 163


InterPro Results:

IPR005508 Domain
PF03754 T[23-139] 3e-09 DUF313
Protein of unknown function DUF313

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 61 9e-10
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 55 2e-07
TF_17_2 ARFNPH4/ARF7 50 7e-06

TOP