AGI ID: At1g01060

TF ID:TF_1_2
Super family:MYB superfamily
Sub family:LHY
Gene name: DNA-binding protein, putative

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At1g01060
MDTNTSGEEL LAKARKPYTI TKQRERWTED EHERFLEALR LYGRAWQRIE EHIGTKTAVQ
IRSHAQKFFT KLEKEAEVKG IPVCQALDIE IPPPRPKRKP NTPYPRKPGN NGTSSSQVSS
AKDAKLVSSA SSSQLNQAFL DLEKMPFSEK TSTGKENQDE NCSGVSTVNK YPLPTKQVSG
DIETSKTSTV DNAVQDVPKK NKDKDGNDGT TVHSMQNYPW HFHADIVNGN IAKCPQNHPS
GMVSQDFMFH PMREETHGHA NLQATTASAT TTASHQAFPA CHSQDDYRSF LQISSTFSNL
IMSTLLQNPA AHAAATFAAS VWPYASVGNS GDSSTPMSSS PPSITAIAAA TVAAATAWWA
SHGLLPVCAP APITCVPFST VAVPTPAMTE MDTVENTQPF EKQNTALQDQ NLASKSPASS
SDDSDETGVT KLNADSKTND DKIEEVVVTA AVHDSNTAQK KNLVDRSSCG SNTPSGSDAE
TDALDKMEKD KEDVKETDEN QPDVIELNNR KIKMRDNNSN NNATTDSWKE VSEEGRIAFQ
ALFARERLPQ SFSPPQVAEN VNRKQSDTSM PLAPNFKSQD SCAADQEGVV MIGVGTCKSL
KTRQTGFKPY KRCSMEVKES QVGNINNQSD EKVCKRLRLE GEAST
Length = 645 AA.

PSI BLAST Result:

Query: Query sequence of TF_1_2
Sbjct: At1g01060

>At1g01060 DNA-binding protein, putative
          Length = 645

 Score =  978 bits (2528), Expect = 0.0
 Identities = 532/645 (82%), Positives = 532/645 (82%)

Query: 1   MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQ 60
           MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQ
Sbjct: 1   MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQ 60

Query: 61  IRSHAQKFFTKLEKEAEVKGIPVCQALDIEIXXXXXXXXXXXXXXXXXGNNGTSSSQVSS 120
           IRSHAQKFFTKLEKEAEVKGIPVCQALDIEI                 GNNGTSSSQVSS
Sbjct: 61  IRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPRKPGNNGTSSSQVSS 120

Query: 121 AKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSG 180
           AKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSG
Sbjct: 121 AKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSG 180

Query: 181 DIETSKTSTVDNAVQDVPXXXXXXXXXXXTTVHSMQNYPWHFHADIVNGNIAKCPQNHPS 240
           DIETSKTSTVDNAVQDVP           TTVHSMQNYPWHFHADIVNGNIAKCPQNHPS
Sbjct: 181 DIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHADIVNGNIAKCPQNHPS 240

Query: 241 GMVSQDFMFHPMREETHGHANLQXXXXXXXXXXXHQAFPACHSQDDYRSFLQISSTFSNL 300
           GMVSQDFMFHPMREETHGHANLQ           HQAFPACHSQDDYRSFLQISSTFSNL
Sbjct: 241 GMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHSQDDYRSFLQISSTFSNL 300

Query: 301 IMSTLLQNPXXXXXXXXXXSVWPYASVGNSGDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 360
           IMSTLLQNP          SVWPYASVGNSGD                            
Sbjct: 301 IMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPPSITAIAAATVAAATAWWA 360

Query: 361 XHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQTLXXXXXXXX 420
            HGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQ L        
Sbjct: 361 SHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQNLASKSPASS 420

Query: 421 XXXXXETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAE 480
                ETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAE
Sbjct: 421 SDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAE 480

Query: 481 TDALXXXXXXXXXXXXXXXNQPDVIELNNRKIKMRDXXXXXXATTDSWKEVSEEGRIAFQ 540
           TDAL               NQPDVIELNNRKIKMRD      ATTDSWKEVSEEGRIAFQ
Sbjct: 481 TDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNSNNNATTDSWKEVSEEGRIAFQ 540

Query: 541 ALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSL 600
           ALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSL
Sbjct: 541 ALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSL 600

Query: 601 KTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST 645
           KTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST
Sbjct: 601 KTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST 645


InterPro Results:

IPR001005 Domain
PF00249 T[24-69] 5.6e-14 Myb_DNA-binding
SM00717 T[23-71] 2.4e-12 SANT
PS50090 T[19-69] 10.804 MYB_3
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[22-72] 1.6e-25 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[18-76] 5.1e-15 Homeodomain-like
Homeodomain-like
NULL
coil ?[477-498] coiled-coil
seg ?[92-108]?[199-209]?[264-274]?[310-319]?[333-361]?[413-425]?[485-499]?[517-522] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_1_2 MYB superfamilyLHY978 0.0
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1608 e-174
TF_1_4 MYB superfamilyATR1119 2e-27
TF_63 SW13 44 2e-04
TF_10_2 GARPARR-B class 39 4e-04

TOP