AGI ID: At1g01030

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: DNA-binding protein, putative

Amino Acid Sequence:


1
61
121
181
241
301
>At1g01030
MDLSLAPTTT TSSDQEQDRD QELTSNIGAS SSSGPSGNNN NLPMMMIPPP EKEHMFDKVV
TPSDVGKLNR LVIPKQHAER YFPLDSSNNQ NGTLLNFQDR NGKMWRFRYS YWNSSQSYVM
TKGWSRFVKE KKLDAGDIVS FQRGIGDESE RSKLYIDWRH RPDMSLVQAH QFGNFGFNFN
FPTTSQYSNR FHPLPEYNSV PIHRGLNIGN HQRSYYNTQR QEFVGYGYGN LAGRCYYTGS
PLDHRNIVGS EPLVIDSVPV VPGRLTPVML PPLPPPPSTA GKRLRLFGVN MECGNDYNQQ
EESWLVPRGE IGASSSSSSA LRLNLSTDHD DDNDDGDDGD DDQFAKKGKS SLSLNFNP
Length = 358 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At1g01030

>At1g01030 DNA-binding protein, putative
          Length = 358

 Score =  182 bits (463), Expect = 5e-46
 Identities = 46/160 (28%), Positives = 71/160 (43%), Gaps = 20/160 (12%)

Query: 120 VSLLPESEDI--ERKVREGIIDVDGGEEDYE------------VLKRSNTPHMFCKTLTA 165
           +SL P +     + + R+  +  + G                 ++      HMF K +T 
Sbjct: 3   LSLAPTTTTSSDQEQDRDQELTSNIGASSSSGPSGNNNNLPMMMIPPPEKEHMFDKVVTP 62

Query: 166 SDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLT 225
           SD        +P++ AE  FP LD S  +    L  +D +G  WRFR+ Y    + +++T
Sbjct: 63  SDVGKLNRLVIPKQHAERYFP-LDSSNNQNGTLLNFQDRNGKMWRFRYSYWNSSQSYVMT 121

Query: 226 TGWSAFVNKKKLVSGDAVLFLRG-----DDGKLRLGVRRA 260
            GWS FV +KKL +GD V F RG     +  KL +  R  
Sbjct: 122 KGWSRFVKEKKLDAGDIVSFQRGIGDESERSKLYIDWRHR 161


InterPro Results:

IPR003340 Family
PF02362 T[55-164] 2.3e-17 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[87-167] 0.00046 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[25-50]?[172-181]?[270-277]?[314-319]?[328-342] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3182 5e-46
TF_17_1 ARFMONOPTEROS/ARF5168 1e-41
TF_17_2 ARFNPH4/ARF7150 6e-36
TF_22_1 ABI3/VP1FUSCA3130 1e-30
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3120 4e-27

TOP